ETSI releases the first Group Report on Encrypted Traffic Integration, protecting end users from malicious attacks

Sophia Antipolis, 1 September 2021

ETSI’s Industry Specification Group on Encrypted Traffic Integration (ISG ETI) has concluded the early part of its work, by identifying problems arising from pervasive encrypted traffic in communications networks.

Read More...

Citation Marivoet, Wim; and Hema, Aboubacar. 2024. How did households in Mali cope with covariate shocks between 2018 and 2023? Source: IFPRI Africa Regional Office (AFR)

Pick-up single-cell proteomic analysis for quantifying up to 3000 proteins in a Mammalian cell  Nature.com

Pure Air Control Services recently completed an IAQ project that helped fans and hockey players at the Stanley Cup Playoffs breathe easy at Tampa Bay’s Amalie Arena.

130-24 : Final Contract Adjustment - Tourmaline Oil Corp. (TOU & FOU) - Special Cash Dividend

Selected topics in malingering from PubMed, a service of the U.S. National Library of Medicine and National Institutes of Health.

Sebastien Pourrat has brought to Malibu a culinary concept that fuses Basque flavors with SoCal traditions. Casita Basqueria is the continuation of his life's work with food.

The post Sebastien Pourrat: The Basque Country Takes Malibu appeared first on Pepperdine Graphic.

Vincent Malizia helped transform his family business in one the roofing industry's most volatile markets and he's staying hungry.

La mujer, que ha pasado de denunciarte a acusada, se enfrenta a dos años de cárcel por simulación de delito Leer

[Shabelle] Riyadh, Saudi Arabia -- In a compelling speech at the Extraordinary Summit of the Arab States and the Organization of Islamic Cooperation, President Hassan Sheikh Mohamud of Somalia underscored the dire necessity of establishing a Palestinian state as crucial for enduring peace in the Middle East.

The research also reveals entirely new forms of communication that blur the distinction between good and bad uses of AI

Location: Main Library- B105.B64M37 2014

686: Caliph Abd al-Malik Imprisons and Tortures the Patriarch

Satin sheer thigh high stayups stockings from Sarah Borghi. 20 deniers. With Lycra and precious siliconed lace border. Meryl labelled. Colors Bianco,Playa,Chiaro,Sabbia,Fume`,Nero. Sizes 1,2,3. See Sizechart. Price: USD9.73

Help save lives by donating to our charity, AMMALIFE, in this summer's Big Give

Copyright 2020 NPR. To see more, visit SARAH MCCAMMON, HOST: The state of Minnesota is home to the largest Somali population in the United States, tens of thousands of people, many of whom were refugees from civil war. Today, we're talking with two of them who are making history. Abdirizak Abdi and Akram Osman are the first Somali public school principals in Minnesota. That's according to the Sahan Journal, which reports about immigrants in the state. They both just started on the job, which means first figuring out how to do it in the middle of the COVID-19 pandemic. Principal Abdi, Principal Osman, thanks so much for joining us. ABDIRIZAK ABDI: Thank you very much, Sarah. AKRAM OSMAN: Thank you. MCCAMMON: Abdi, I want to start with you. You, as I understand it, never even attended K-12 schools in the United States. You came to Minnesota when you were 19 years old. Where did your interest in education come from? ABDI: I did my school in Africa, specifically in Kenya. So we lived in

Mejía habla sobre formalización laboral

Panelistas consideran que las emociones exacerbadas, las redes sociales y la polarización son elementos que nos mueven hacia la violencia, así no sea una constante en la sociedad.

Escuche el programa de este lunes festivo 8 de enero. La Luciérnaga, un espacio de humor y opinión de Caracol Radio que acompaña por más de 30 años a sus oyentes en su regreso a casa. 

Esta decisión del ente acusador de acusar a Álvaro Uribe Vélez ha generado opiniones divididas en Colombia

Police are investigating a car fire that happened in Pembroke yesterday [Nov 3], noting that “there were items recovered at the scene to suggest the fire was maliciously set.” A police spokesperson said, “Around 9:40am on Sunday, November 3, 2024, police, along with Bermuda Fire and Rescue Service, responded to a report of a car […]

Piráti musí přestat řešit vnitřní spory a vrátit se k tomu, co voliče nejvíc zajímá, říká nový předseda strany Zdeněk Hřib v prvním rozhovoru po zvolení v podcastu Padni komu padni. Nejdůležitější je dle něj zlepšit kampaně, aby pirátští voliči přišli k volbám. Bez nich by dle Hřiba ze sněmovny zmizel liberální hlas.

Animalities have returned to Mortal Kombat. Players of the infamous fighting game series can finish a defeated opponent off by transforming into an animal and brutally mauling them death for the first time since 1995's Mortal Kombat 3 with the "Khaos Reigns" update to Mortal Kombat 1.

So, what follows is a list of every Mortal Kombatant's fursonas, basically, from Mortal Kombat 1. Two warnings: In explaining different characters roles, there may be spoilers for the games, and also, extreme, over the top violence and gore is the point of Animalities.

read more

By Tara Ariano Published: November 11th, 2024

INTERPOL on Tuesday said it took down more than 22,000 malicious servers linked to various cyber threats as part of a global operation. Dubbed Operation Synergia II, the coordinated effort ran from April 1 to August 31, 2024, targeting phishing, ransomware, and information stealer infrastructure. "Of the approximately 30,000 suspicious IP addresses identified, 76 per cent were taken down and 59

Cybersecurity researchers are warning that a command-and-control (C&C) framework called Winos is being distributed within gaming-related applications like installation tools, speed boosters, and optimization utilities. "Winos 4.0 is an advanced malicious framework that offers comprehensive functionality, a stable architecture, and efficient control over numerous online endpoints to execute

Cybersecurity researchers have discovered a malicious package on the Python Package Index (PyPI) that has racked up thousands of downloads for over three years while stealthily exfiltrating developers' Amazon Web Services (AWS) credentials. The package in question is "fabrice," which typosquats a popular Python library known as "fabric," which is designed to execute shell commands remotely over

A new campaign has targeted the npm package repository with malicious JavaScript libraries that are designed to infect Roblox users with open-source stealer malware such as Skuld and Blank-Grabber. "This incident highlights the alarming ease with which threat actors can launch supply chain attacks by exploiting trust and human error within the open source ecosystem, and using readily available

Somalia insisted Saturday that Ethiopia will not be part of a new African Union peacekeeping mission, as the two nations remain locked in a dispute that has sent shivers through the Horn of Africa.

The human cardiovascular system has adapted to function optimally in Earth's 1G gravity, and microgravity conditions cause myocardial abnormalities, including atrophy and dysfunction. However, the underlying mechanisms linking microgravity and cardiac anomalies are incompletely understood. In this study, we investigated whether and how calpain activation promotes myocardial abnormalities under simulated microgravity conditions. Simulated microgravity was induced by tail suspension in mice with cardiomyocyte-specific deletion of Capns1, which disrupts activity and stability of calpain-1 and calpain-2, and their WT littermates. Tail suspension time-dependently reduced cardiomyocyte size, heart weight, and myocardial function in WT mice, and these changes were accompanied by calpain activation, NADPH oxidase activation, and oxidative stress in heart tissues. The effects of tail suspension were attenuated by deletion of Capns1. Notably, the protective effects of Capns1 deletion were associated with the prevention of phosphorylation of Ser-345 on p47phox and attenuation of ERK1/2 and p38 activation in hearts of tail-suspended mice. Using a rotary cell culture system, we simulated microgravity in cultured neonatal mouse cardiomyocytes and observed decreased total protein/DNA ratio and induced calpain activation, phosphorylation of Ser-345 on p47phox, and activation of ERK1/2 and p38, all of which were prevented by calpain inhibitor-III. Furthermore, inhibition of ERK1/2 or p38 attenuated phosphorylation of Ser-345 on p47phox in cardiomyocytes under simulated microgravity. This study demonstrates for the first time that calpain promotes NADPH oxidase activation and myocardial abnormalities under microgravity by facilitating p47phox phosphorylation via ERK1/2 and p38 pathways. Thus, calpain inhibition may be an effective therapeutic approach to reduce microgravity-induced myocardial abnormalities.

Qiang Tian
Oct 1, 2004; 3:960-969
Research

Jürgen Cox
Sep 1, 2014; 13:2513-2526
Technological Innovation and Resources

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Stop codon read-through (SCR) is a process of continuation of translation beyond a stop codon. This phenomenon, which occurs only in certain mRNAs under specific conditions, leads to a longer isoform with properties different from that of the canonical isoform. MTCH2, which encodes a mitochondrial protein that regulates mitochondrial metabolism, was selected as a potential read-through candidate based on evolutionary conservation observed in the proximal region of its 3' UTR. Here, we demonstrate translational read-through across two evolutionarily conserved, in-frame stop codons of MTCH2 using luminescence- and fluorescence-based assays, and by analyzing ribosome-profiling and mass spectrometry (MS) data. This phenomenon generates two isoforms, MTCH2x and MTCH2xx (single- and double-SCR products, respectively), in addition to the canonical isoform MTCH2, from the same mRNA. Our experiments revealed that a cis-acting 12-nucleotide sequence in the proximal 3' UTR of MTCH2 is the necessary signal for SCR. Functional characterization showed that MTCH2 and MTCH2x were localized to mitochondria with a long t1/2 (>36 h). However, MTCH2xx was found predominantly in the cytoplasm. This mislocalization and its unique C terminus led to increased degradation, as shown by greatly reduced t1/2 (<1 h). MTCH2 read-through–deficient cells, generated using CRISPR-Cas9, showed increased MTCH2 expression and, consistent with this, decreased mitochondrial membrane potential. Thus, double-SCR of MTCH2 regulates its own expression levels contributing toward the maintenance of normal mitochondrial membrane potential.

Olha Prykhodko and Kostiantyn Ralchenko
Theor. Probability and Math. Statist. 111 (), 123-135.
Abstract, references and article information

Paweł Hitczenko and Nick Wormald
Proc. Amer. Math. Soc. 152 (), 5411-5427.
Abstract, references and article information

Reliable, specific polyclonal and monoclonal antibodies are important tools in research and medicine. However, the discovery of antibodies against their targets in their native forms is difficult. Here, we present a novel method for discovery of antibodies against membrane proteins in their native configuration in mammalian cells. The method involves the co-expression of an antibody library in a population of mammalian cells that express the target polypeptide within a natural membrane environment on the cell surface. Cells that secrete a single-chain fragment variable (scFv) that binds to the target membrane protein thereby become self-labeled, enabling enrichment and isolation by magnetic sorting and FRET-based flow sorting. Library sizes of up to 109 variants can be screened, thus allowing campaigns of naïve scFv libraries to be selected against membrane protein antigens in a Chinese hamster ovary cell system. We validate this method by screening a synthetic naïve human scFv library against Chinese hamster ovary cells expressing the oncogenic target epithelial cell adhesion molecule and identify a panel of three novel binders to this membrane protein, one with a dissociation constant (KD) as low as 0.8 nm. We further demonstrate that the identified antibodies have utility for killing epithelial cell adhesion molecule–positive cells when used as a targeting domain on chimeric antigen receptor T cells. Thus, we provide a new tool for identifying novel antibodies that act against membrane proteins, which could catalyze the discovery of new candidates for antibody-based therapies.

20 August 2020

What will authorizing the return of US troops mean for Somalia? Explainer Video aboudiaf.drupal 17 June 2022

Ahmed Soliman examines what the reintroduction of US military means for Somalia.

He says the strategy remains to try and reduce al-Shabaab’s threat, suppress its ability to carry out operations, and target its senior leadership.

There is more of a recognition now that the focus needs to be on restoring an effective security sector within Somalia and ensuring their forces are ready, but this also requires better coordination between the federal government and federal member states which it is hoped will happen in this new administration.

What challenges does the new president of Somalia face? Explainer Video aboudiaf.drupal 28 June 2022

Ahmed Soliman examines the challenges the new president Hassan Sheikh Mohamud faces in his first 100 days as president.

Key issues for the new administration are a deteriorating situation with regards to drought as close to half the population are facing food insecurity due to a fourth failed rainy season.

Combined with an inflation rate above ten per cent, many Somalis are at risk of famine and starvation. Many areas of the country are affected from the pastoralist regions to those which house IDP camps around the capital city and other towns, all being exacerbated by the war in Ukraine as Somalia was importing much of its wheat imports from Ukraine and Russia.

Functions of the gut microbiome have a growing number of implications for host metabolic health, with diet being one of the most significant influences on microbiome composition. Compelling links between diet and the gut microbiome suggest key roles for various macronutrients, including lipids, yet how individual classes of dietary lipids interact with the microbiome remains largely unknown. Sphingolipids are bioactive components of most foods and are also produced by prominent gut microbes. This makes sphingolipids intriguing candidates for shaping diet–microbiome interactions. Here, we used a click chemistry–based approach to track the incorporation of bioorthogonal dietary omega-alkynyl sphinganine (sphinganine alkyne [SAA]) into the murine gut microbial community (Bioorthogonal labeling). We identified microbial and SAA-specific metabolic products through fluorescence-based sorting of SAA-containing microbes (Sort), 16S rRNA gene sequencing to identify the sphingolipid-interacting microbes (Seq), and comparative metabolomics to identify products of SAA assimilation by the microbiome (Spec). Together, this approach, termed Bioorthogonal labeling-Sort-Seq-Spec (BOSSS), revealed that SAA assimilation is nearly exclusively performed by gut Bacteroides, indicating that sphingolipid-producing bacteria play a major role in processing dietary sphinganine. Comparative metabolomics of cecal microbiota from SAA-treated mice revealed conversion of SAA to a suite of dihydroceramides, consistent with metabolic activities of Bacteroides and Bifidobacterium. Additionally, other sphingolipid-interacting microbes were identified with a focus on an uncharacterized ability of Bacteroides and Bifidobacterium to metabolize dietary sphingolipids. We conclude that BOSSS provides a platform to study the flux of virtually any alkyne-labeled metabolite in diet–microbiome interactions.

Paramphistomosis, caused by the rumen fluke, Calicophoron daubneyi, is a parasitic infection of ruminant livestock which has seen a rapid rise in prevalence throughout Western Europe in recent years. Following ingestion of metacercariae (parasite cysts) by the mammalian host, newly-excysted juveniles (NEJs) emerge and invade the duodenal submucosa which causes significant pathology in heavy infections. The immature larvae then migrate upwards, along the gastrointestinal tract, and enter the rumen where they mature and begin to produce eggs. Despite their emergence, and sporadic outbreaks of acute disease, we know little about the molecular mechanisms used by C. daubneyi to establish infection, acquire nutrients and to avoid the host immune response. Here, transcriptome analysis of four intra-mammalian life-cycle stages, integrated with secretome analysis of the NEJ and adult parasites (responsible for acute and chronic disease respectively), revealed how the expression and secretion of selected families of virulence factors and immunomodulators are regulated in accordance with fluke development and migration. Our data show that whilst a family of cathepsins B with varying S2 sub-site residues (indicating distinct substrate specificities) are differentially secreted by NEJs and adult flukes, cathepsins L and F are secreted in low abundance by NEJs only. We found that C. daubneyi has an expanded family of aspartic peptidases, which is up-regulated in adult worms, although they are underrepresented in the secretome. The most abundant proteins in adult fluke secretions were helminth defence molecules (HDMs) that likely establish an immune environment permissive to fluke survival and/or neutralise pathogen-associated molecular patterns (PAMPs) such as bacterial lipopolysaccharide in the microbiome-rich rumen. The distinct collection of molecules secreted by C. daubneyi allowed the development of the first coproantigen-based ELISA for paramphistomosis which, importantly, did not recognise antigens from other helminths commonly found as co-infections with rumen fluke.

Disruptive technologies by nation states and malign cyber actors – the US response 16 February 2023 — 1:00PM TO 2:00PM Anonymous (not verified) 2 February 2023 Chatham House and Online

Lisa Monaco, the US deputy attorney general, discusses how autocratic governments and malign cyber actors use disruptive technologies to project power and engage in illicit activity.

Weaponizing data, ransomware attacks and other illicit cyber activity represent significant threats to national security. 

Governments and malicious cyber actors around the world exploit disruptive technology to engage in criminal activity, track citizens and coerce other countries thereby weakening the rules-based order and fundamental principles of democracy. 

Lisa Monaco discusses how the world is at an inflection point when it comes to meeting this challenge and describes how the US and partner nations are responding to protect their citizens and the broader international community.

Key questions to discuss include:

• What steps does the US government need to take to properly address this threat?
• How are countries coordinating policies to confront the problem?
• To what extent does this challenge go beyond US-China competition?

As with all member events, questions from the audience drive the conversation.

Read the transcript.