actor Another Classic Trek Actor On Lower Decks This Week By trektoday.com Published On :: Tue, 21 Sep 2021 18:16:13 +0000 Per the Star Trek On Paramount+ Twitter account, this week’s episode of Star Trek: Lower Decks will feature... Full Article Star Trek: Lower Decks
actor This halloween I am dressed as a withered husk, who was made this way by: Satisfactory 1.0 By radar.spacebar.org Published On :: Thu, 31 Oct 2024 22:35:04 -0400 OMG. I can't believe October is over already. I blame Satisfactory which, okay, I do get it now, and it did destroy my body and mind. I am inches from being done now; I just want to make sure that I finish it with enough force that I do actually put it away, as I could imagine tinkering with my saddest factory forever. The game isn't without flaw, but I think most of those flaws are not interesting to talk about. I do have one petty but important criticism, which is mildly spoilerful and anyway will only be interesting if you played the game. There is an object called the Somersloop ("cool S") which allows you to double the output of a machine. Canonically this item is some kind of "loop" and the flavor text talks about how it is able to create more energy than you put into it. So when I'm out hunting for Korok seeds I have this thought that maybe I could create a loop of factories whereby it would create infinite resources by repeatedly doubling. And I'm thinking about it but the crafting tree doesn't have any notable loops in it, but I remember the "packager" which allows you to put a fluid in a container or the converse, and I'm like: Yes, that's great! So I get back to base and I am doing this, just for fun to create an infinite fuel factory or whatever, and I realize that the packager just doesn't have a slot for a Somersloop. They must just hate fun, elegant twists. It would not break the game to allow this (you can always get infinite resources lots of other ways) or cause any other problem I can think of. Hmph! The thing about constructing a factory and watching it churn is that it's basically the same thing as a programming project that you invented for yourself, and it's probably better to do the programming project. Here's progress on my mysterious rectangle: Minusweeper 2 It's good progress if I do say so myself! Anything but black here is a Satisfactory result, which is 90.55% of them at this point. I may need heavy machinery for the remaining 9.45%, but that is part of the fun. I think that's really it for this month! Please vote in the US Elections if you can (but I guess also vote in any important elections. And obviously, vote for the good guys???). And happy Halloween! Full Article
actor Megan Staffel’s Book Notes music playlist for her novel The Causative Factor By largeheartedboy.com Published On :: Mon, 11 Nov 2024 22:55:40 +0000 "...while I’m writing I need total silence, but even so, the music shares such a similar landscape with the text it’s hard to believe it wasn’t present from the beginning." Full Article Author Playlists books Megan Staffel music playlists
actor Ford is slashing the working hours of some of its German factory employees amid what it calls a 'significantly lower than expected' demand for its EVs By biztoc.com Published On :: Wed, 13 Nov 2024 07:01:53 GMT Ford is getting its workers in Cologne, Germany, to work fewer hours. The carmaker said a "lower than expected demand for electric vehicles" brought on the shift. The carmaker has more than 4,000 employees at its Cologne plant. Ford is slashing the work hours of its manufacturing plant workers in… Full Article
actor How Working with Theatre Actors Enhanced our Indie Horror/Mystery NightGhast By news.xbox.com Published On :: Fri, 21 Jun 2024 17:00:00 +0000 The post How Working with Theatre Actors Enhanced our Indie Horror/Mystery NightGhast appeared first on Xbox Wire. Full Article Games ID@Xbox NightGhast playstige
actor Google Cloud to Enforce Multi-Factor Authentication by 2025 for All Users By thehackernews.com Published On :: Wed, 06 Nov 2024 11:07:00 +0530 Google's cloud division has announced that it will enforce mandatory multi-factor authentication (MFA) for all users by the end of 2025 as part of its efforts to improve account security. "We will be implementing mandatory MFA for Google Cloud in a phased approach that will roll out to all users worldwide during 2025," Mayank Upadhyay, vice president of engineering and distinguished engineer at Full Article
actor Ulyanovsky Cartridge Manufacturing Factory By englishrussia.com Published On :: Wed, 09 Feb 2022 04:26:54 +0000 The post Ulyanovsky Cartridge Manufacturing Factory appeared first on English Russia. Full Article Photos Technology factory industry military production
actor Soviet Actors and Actresses Get Beautified By englishrussia.com Published On :: Wed, 23 Feb 2022 14:37:34 +0000 The post Soviet Actors and Actresses Get Beautified appeared first on English Russia. Full Article Photos Russian People Society celebrities movie
actor Saoirse Ronan says her experience as a child actor continues to shape her work By www.npr.org Published On :: Wed, 06 Nov 2024 11:11:39 -0500 Ronan credits her parents and the filmmakers she worked with as a child for keeping acting fun. She stars as a woman struggling with addiction in The Outrun and as a World War II mother in Blitz. Full Article
actor Nuclear-powered aircraft carriers would give China's growing navy new reach, and researchers say it's working on the reactor to power one By www.businessinsider.com Published On :: Tue, 12 Nov 2024 18:40:30 +0000 A nuclear-powered aircraft carrier, like American carriers, would be a major jump for China, giving its navy a global reach. Full Article Military & Defense defense satellite-images china nuclear-power aircraft-carrier
actor Ford is slashing hours for some German factory employees amid lower EV demand By www.businessinsider.com Published On :: Wed, 13 Nov 2024 06:10:20 +0000 The carmaker has more than 4,000 employees at its Cologne plant. It also has another plant in Saarlouis, in southwestern Germany. Full Article Transportation ford ev germany
actor Enabling Two-Factor Authentication (2FA) for a PayPal Account By www.tipsandtricks-hq.com Published On :: Sat, 19 Sep 2020 23:54:17 +0000 2FA, the common abbreviation for two-factor authentication is a word often spoken about when one is setting up a website or account where security is vital. With more and more confidential information being uploaded on the net, it makes sense to add additional measures to prevent hackers from gaining access to an account. In terms […] The post Enabling Two-Factor Authentication (2FA) for a PayPal Account appeared first on Tips and Tricks HQ. Full Article Shop Admin Tips Tech Tips 2FA login security Password Protection Paypal PayPal Tutorials protect admin login Secure Login Security Two Factor Authentication
actor Factoring In PayPal Fees When Sending Money Using the Goods and Services Option By www.tipsandtricks-hq.com Published On :: Wed, 12 May 2021 00:48:45 +0000 With more and more online marketplaces popping up, many individuals prefer to pay for items, whether they be new or second hand using the PayPal Goods and Services option. The PayPal ‘Goods and Services’ option gives buyers further peace of mind with the PayPal guarantee. If the seller does not provide what they have described, […] The post Factoring In PayPal Fees When Sending Money Using the Goods and Services Option appeared first on Tips and Tricks HQ. Full Article General Shop Admin Tips Paypal paypal donation PayPal Tutorials Transfer Money
actor News24 Business | Google to use small nuclear reactors for AI-intensive data centres By www.news24.com Published On :: Tuesday Oct 15 2024 08:50:11 Google is investing in the development of the next generation of nuclear power, backing a company that’s building small modular reactors and agreeing to purchase energy once the sites start supplying US grids. Full Article
actor News24 | Two people arrested over murder of ‘Noem My Skollie’ actor, insurance fraud suspected By www.news24.com Published On :: Tuesday Nov 12 2024 21:31:55 Cape Town police have arrested two suspects in connection with the murder of Noem My Skollie actor David Manuel and his friend, Alfonso Fisher, in Gugulethu last month. Full Article
actor Time-resolved Mass Spectrometry of Tyrosine Phosphorylation Sites in the Epidermal Growth Factor Receptor Signaling Network Reveals Dynamic Modules By www.mcponline.org Published On :: 2005-09-01 Yi ZhangSep 1, 2005; 4:1240-1250Research Full Article
actor Amyloid precursor protein is a restriction factor that protects against Zika virus infection in mammalian brains [Gene Regulation] By www.jbc.org Published On :: 2020-12-11T00:06:20-08:00 Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries. Full Article
actor Hepatocyte nuclear factor 1{beta} suppresses canonical Wnt signaling through transcriptional repression of lymphoid enhancer-binding factor 1 [Molecular Bases of Disease] By www.jbc.org Published On :: 2020-12-18T00:06:18-08:00 Hepatocyte nuclear factor-1β (HNF-1β) is a tissue-specific transcription factor that is required for normal kidney development and renal epithelial differentiation. Mutations of HNF-1β produce congenital kidney abnormalities and inherited renal tubulopathies. Here, we show that ablation of HNF-1β in mIMCD3 renal epithelial cells results in activation of β-catenin and increased expression of lymphoid enhancer–binding factor 1 (LEF1), a downstream effector in the canonical Wnt signaling pathway. Increased expression and nuclear localization of LEF1 are also observed in cystic kidneys from Hnf1b mutant mice. Expression of dominant-negative mutant HNF-1β in mIMCD3 cells produces hyperresponsiveness to exogenous Wnt ligands, which is inhibited by siRNA-mediated knockdown of Lef1. WT HNF-1β binds to two evolutionarily conserved sites located 94 and 30 kb from the mouse Lef1 promoter. Ablation of HNF-1β decreases H3K27 trimethylation repressive marks and increases β-catenin occupancy at a site 4 kb upstream to Lef1. Mechanistically, WT HNF-1β recruits the polycomb-repressive complex 2 that catalyzes H3K27 trimethylation. Deletion of the β-catenin–binding domain of LEF1 in HNF-1β–deficient cells abolishes the increase in Lef1 transcription and decreases the expression of downstream Wnt target genes. The canonical Wnt target gene, Axin2, is also a direct transcriptional target of HNF-1β through binding to negative regulatory elements in the gene promoter. These findings demonstrate that HNF-1β regulates canonical Wnt target genes through long-range effects on histone methylation at Wnt enhancers and reveal a new mode of active transcriptional repression by HNF-1β. Full Article
actor MicroRNA-98 reduces nerve growth factor expression in nicotine-induced airway remodeling [Gene Regulation] By www.jbc.org Published On :: 2020-12-25T00:06:30-08:00 Evolving evidence suggests that nicotine may contribute to impaired asthma control by stimulating expression of nerve growth factor (NGF), a neurotrophin associated with airway remodeling and airway hyperresponsiveness. We explored the hypothesis that nicotine increases NGF by reducing lung fibroblast (LF) microRNA-98 (miR-98) and PPARγ levels, thus promoting airway remodeling. Levels of NGF, miR-98, PPARγ, fibronectin 1 (FN1), endothelin-1 (EDN1, herein referred to as ET-1), and collagen (COL1A1 and COL3A1) were measured in human LFs isolated from smoking donors, in mouse primary LFs exposed to nicotine (50 μg/ml), and in whole lung homogenates from mice chronically exposed to nicotine (100 μg/ml) in the drinking water. In selected studies, these pathways were manipulated in LFs with miR-98 inhibitor (anti-miR-98), miR-98 overexpression (miR-98 mimic), or the PPARγ agonist rosiglitazone. Compared with unexposed controls, nicotine increased NGF, FN1, ET-1, COL1A1, and COL3A1 expression in human and mouse LFs and mouse lung homogenates. In contrast, nicotine reduced miR-98 levels in LFs in vitro and in lung homogenates in vivo. Treatment with anti-miR-98 alone was sufficient to recapitulate increases in NGF, FN1, and ET-1, whereas treatment with a miR-98 mimic significantly suppressed luciferase expression in cells transfected with a luciferase reporter linked to the putative seed sequence in the NGF 3'UTR and also abrogated nicotine-induced increases in NGF, FN1, and ET-1 in LFs. Similarly, rosiglitazone increased miR-98 and reversed nicotine-induced increases in NGF, FN1, and ET-1. Taken together, these findings demonstrate that nicotine-induced increases in NGF and other markers of airway remodeling are negatively regulated by miR-98. Full Article
actor Flexible Distribution Systems: New Services, Actors and Technologies By www.chathamhouse.org Published On :: Tue, 31 Jul 2018 12:10:01 +0000 Flexible Distribution Systems: New Services, Actors and Technologies 4 September 2018 — 9:00AM TO 10:30AM Anonymous (not verified) 31 July 2018 Chatham House, London The pace of the energy transition is accelerating. Solar and wind are dramatically falling in cost and displacing fossil fuel generators. Simultaneously, the rapid uptake of electric vehicles and battery storage systems are beginning to send shock-waves through the electricity sector. As the proportion of distributed energy resources (DERs) connected to the distribution network grows, a significant opportunity is beginning to present itself. What if the concerns of renewable integration and associated costs could be solved by the smart integration of these DERs? By properly valuing the services DERs can provide, actively managing the distribution system and creating new market places, might a truly renewable electricity system capable of supporting the electrification of heat and transport be possible?During this roundtable, Andrew Scobie, CEO of Faraday Grid, will provide an overview of the challenges and opportunities faced within the distribution network and explain why the current system is no longer fit for purpose. This is the inaugural event in the Energy Transitions Roundtable (ETR) series. Full Article
actor Threshold approximations for the exponential of a factorized operator family with correctors taken into account By www.ams.org Published On :: Fri, 08 Nov 2024 14:08 EST T. A. Suslina St. Petersburg Math. J. 35 (), 537-570. Abstract, references and article information Full Article
actor Carnosine synthase deficiency is compatible with normal skeletal muscle and olfactory function but causes reduced olfactory sensitivity in aging mice [Developmental Biology] By www.jbc.org Published On :: 2020-12-11T00:06:20-08:00 Carnosine (β-alanyl-l-histidine) and anserine (β-alanyl-3-methyl-l-histidine) are abundant peptides in the nervous system and skeletal muscle of many vertebrates. Many in vitro and in vivo studies demonstrated that exogenously added carnosine can improve muscle contraction, has antioxidant activity, and can quench various reactive aldehydes. Some of these functions likely contribute to the proposed anti-aging activity of carnosine. However, the physiological role of carnosine and related histidine-containing dipeptides (HCDs) is not clear. In this study, we generated a mouse line deficient in carnosine synthase (Carns1). HCDs were undetectable in the primary olfactory system and skeletal muscle of Carns1-deficient mice. Skeletal muscle contraction in these mice, however, was unaltered, and there was no evidence for reduced pH-buffering capacity in the skeletal muscle. Olfactory tests did not reveal any deterioration in 8-month-old mice lacking carnosine. In contrast, aging (18–24-month-old) Carns1-deficient mice exhibited olfactory sensitivity impairments that correlated with an age-dependent reduction in the number of olfactory receptor neurons. Whereas we found no evidence for elevated levels of lipoxidation and glycation end products in the primary olfactory system, protein carbonylation was increased in the olfactory bulb of aged Carns1-deficient mice. Taken together, these results suggest that carnosine in the olfactory system is not essential for information processing in the olfactory signaling pathway but does have a role in the long-term protection of olfactory receptor neurons, possibly through its antioxidant activity. Full Article
actor The glucose-sensing transcription factor ChREBP is targeted by proline hydroxylation [Metabolism] By www.jbc.org Published On :: 2020-12-11T00:06:20-08:00 Cellular energy demands are met by uptake and metabolism of nutrients like glucose. The principal transcriptional regulator for adapting glycolytic flux and downstream pathways like de novo lipogenesis to glucose availability in many cell types is carbohydrate response element–binding protein (ChREBP). ChREBP is activated by glucose metabolites and post-translational modifications, inducing nuclear accumulation and regulation of target genes. Here we report that ChREBP is modified by proline hydroxylation at several residues. Proline hydroxylation targets both ectopically expressed ChREBP in cells and endogenous ChREBP in mouse liver. Functionally, we found that specific hydroxylated prolines were dispensable for protein stability but required for the adequate activation of ChREBP upon exposure to high glucose. Accordingly, ChREBP target gene expression was rescued by re-expressing WT but not ChREBP that lacks hydroxylated prolines in ChREBP-deleted hepatocytes. Thus, proline hydroxylation of ChREBP is a novel post-translational modification that may allow for therapeutic interference in metabolic diseases. Full Article
actor Serum lipoprotein-derived fatty acids regulate hypoxia-inducible factor [Metabolism] By www.jbc.org Published On :: 2020-12-25T00:06:31-08:00 Oxygen regulates hypoxia-inducible factor (HIF) transcription factors to control cell metabolism, erythrogenesis, and angiogenesis. Whereas much has been elucidated about how oxygen regulates HIF, whether lipids affect HIF activity is un-known. Here, using cultured cells and two animal models, we demonstrate that lipoprotein-derived fatty acids are an independent regulator of HIF. Decreasing extracellular lipid supply inhibited HIF prolyl hydroxylation, leading to accumulation of the HIFα subunit of these heterodimeric transcription factors comparable with hypoxia with activation of downstream target genes. The addition of fatty acids to culture medium suppressed this signal, which required an intact mitochondrial respiratory chain. Mechanistically, fatty acids and oxygen are distinct signals integrated to control HIF activity. Finally, we observed lipid signaling to HIF and changes in target gene expression in developing zebrafish and adult mice, and this pathway operates in cancer cells from a range of tissues. This study identifies fatty acids as a physiological modulator of HIF, defining a mechanism for lipoprotein regulation that functions in parallel to oxygen. Full Article
actor The Annual Journal Impact Factor Saga By jnm.snmjournals.org Published On :: 2021-07-08T14:20:31-07:00 Full Article
actor Unraveling the MAX2 Protein Network in Arabidopsis thaliana: Identification of the Protein Phosphatase PAPP5 as a Novel MAX2 Interactor By www.mcponline.org Published On :: 2020-12-28 Sylwia StrukDec 28, 2020; 0:RA119.001766v1-mcp.RA119.001766Research Full Article
actor VBP1 modulates Wnt/{beta}-catenin signaling by mediating the stability of the transcription factors TCF/LEFs [Signal Transduction] By www.jbc.org Published On :: 2020-12-04T00:06:06-08:00 The Wnt/β-catenin pathway is one of the major pathways that regulates embryonic development, adult homeostasis, and stem cell self-renewal. In this pathway, transcription factors T-cell factor and lymphoid enhancer factor (TCF/LEF) serve as a key switch to repress or activate Wnt target gene transcription by recruiting repressor molecules or interacting with the β-catenin effector, respectively. It has become evident that the protein stability of the TCF/LEF family members may play a critical role in controlling the activity of the Wnt/β-catenin signaling pathway. However, factors that regulate the stability of TCF/LEFs remain largely unknown. Here, we report that pVHL binding protein 1 (VBP1) regulates the Wnt/β-catenin signaling pathway by controlling the stability of TCF/LEFs. Surprisingly, we found that either overexpression or knockdown of VBP1 decreased Wnt/β-catenin signaling activity in both cultured cells and zebrafish embryos. Mechanistically, VBP1 directly binds to all four TCF/LEF family members and von Hippel-Lindau tumor-suppressor protein (pVHL). Either overexpression or knockdown of VBP1 increases the association between TCF/LEFs and pVHL and then decreases the protein levels of TCF/LEFs via proteasomal degradation. Together, our results provide mechanistic insights into the roles of VBP1 in controlling TCF/LEFs protein stability and regulating Wnt/β-catenin signaling pathway activity. Full Article
actor Transcription factor NF-{kappa}B promotes acute lung inȷury via microRNA-99b-mediated PRDM1 down-regulation [Developmental Biology] By www.jbc.org Published On :: 2020-12-25T00:06:31-08:00 Acute lung injury (ALI), is a rapidly progressing heterogenous pulmonary disorder that possesses a high risk of mortality. Accumulating evidence has implicated the activation of the p65 subunit of NF-κB [NF-κB(p65)] activation in the pathological process of ALI. microRNAs (miRNAs), a group of small RNA molecules, have emerged as major governors due to their post-transcriptional regulation of gene expression in a wide array of pathological processes, including ALI. The dysregulation of miRNAs and NF-κB activation has been implicated in human diseases. In the current study, we set out to decipher the convergence of miR-99b and p65 NF-κB activation in ALI pathology. We measured the release of pro-inflammatory cytokines (IL-1β, IL-6, and TNFα) in bronchoalveolar lavage fluid using ELISA. MH-S cells were cultured and their viability were detected with cell counting kit 8 (CCK8) assays. The results showed that miR-99b was up-regulated, while PRDM1 was down-regulated in a lipopolysaccharide (LPS)-induced murine model of ALI. Mechanistic investigations showed that NF-κB(p65) was enriched at the miR-99b promoter region, and further promoted its transcriptional activity. Furthermore, miR-99b targeted PRDM1 by binding to its 3'UTR, causing its down-regulation. This in-creased lung injury, as evidenced by increased wet/dry ratio of mouse lung, myeloperoxidase activity and pro-inflammatory cytokine secretion, and enhanced infiltration of inflammatory cells in lung tissues. Together, our findings indicate that NF-κB(p65) promotion of miR-99b can aggravate ALI in mice by down-regulating the expression of PRDM1. Full Article
actor Unraveling the MAX2 Protein Network in Arabidopsis thaliana: Identification of the Protein Phosphatase PAPP5 as a Novel MAX2 Interactor [Research] By www.mcponline.org Published On :: 2020-12-28T07:35:13-08:00 The F-box protein MORE AXILLARY GROWTH 2 (MAX2) is a central component in the signaling cascade of strigolactones (SLs) as well as of the smoke derived karrikins (KARs) and the so far unknown endogenous KAI2 ligand (KL). The two groups of molecules are involved in overlapping and unique developmental processes, and signal-specific outcomes are attributed to perception by the paralogous α/β-hydrolases DWARF14 (D14) for SL and KARRIKIN INSENSITIVE 2/ HYPOSENSITIVE TO LIGHT (KAI2/HTL) for KAR/KL. Additionally, depending on which receptor is activated, specific members of the SUPPRESSOR OF MAX2 1 (SMAX1) – LIKE (SMXL) family control KAR/KL and SL responses. As proteins that function in the same signal transduction pathway often occur in large protein complexes, we aimed at discovering new players of the MAX2, D14 and KAI2 protein network by tandem affinity purification using Arabidopsis cell cultures. When using MAX2 as a bait, various proteins were co-purified among which general components of the Skp1-Cullin-F-box complex and members of the CONSTITUTIVE PHOTOMORPHOGENIC 9 signalosome. Here, we report the identification of a novel interactor of MAX2, a type 5 serine/threonine protein phosphatase, designated PHYTOCHROME-ASSOCIATED PROTEIN PHOSPHATASE 5 (PAPP5). Quantitative affinity purification pointed at PAPP5 as being more present in KAI2 rather than D14 protein complexes. In agreement, mutant analysis suggests that PAPP5 modulates KAR/KL-dependent seed germination in suboptimal conditions and seedling development. Additionally, a phosphopeptide enrichment experiment revealed that PAPP5 might dephosphorylate MAX2 in vivo independently of the synthetic strigolactone analog, rac-GR24. Together, by analyzing the protein complexes to which MAX2, D14 and KAI2 belong, we revealed a new MAX2 interactor, PAPP5, that might act through dephosphorylation of MAX2 to control mainly KAR/KL- related phenotypes and, hence, provide another link with the light pathway. Full Article
actor The Role of Sub-state and Non-state Actors in International Climate Processes: Civil Society By www.chathamhouse.org Published On :: Tue, 27 Nov 2018 09:59:58 +0000 The Role of Sub-state and Non-state Actors in International Climate Processes: Civil Society Research paper sysadmin 27 November 2018 Given today’s challenging geopolitical conditions and the evolving nature of the international climate regime since Paris, civil society must now once again recalibrate its strategies to ensure continued and increasing relevance. — Photo by The Climate Reality Project, ‘People’s Climate March Protest’, via Unsplash, 2017. This is one of four background papers feeding into a synthesis paper entitled The Role of Sub-state and Non-state Actors in International Climate Processes. Summary Following the failure of the 15th Conference of the Parties (COP 15) in Copenhagen in 2009, there was a step change in the sophistication and unity of civil society engagement on climate policy. This ensured that, subsequently, civil society was more effective in exercising multiple channels of influence around the negotiations for the Paris Agreement in 2015. Civil society proved to be particularly effective at harnessing the twin narratives of climate science and economics, and at leveraging an emerging multi-level governance architecture, to create political space for climate leadership. Given today’s challenging geopolitical conditions and the evolving nature of the international climate regime since Paris, civil society must now once again recalibrate its strategies to ensure continued and increasing relevance. In particular, the shift to a more ‘nationally grounded’ implementation regime focusing on individual states’ climate commitments will require civil society to become more effective at influencing domestic politics. At the same time, civil society will need to continue to seek strategic synergies at the international level. Civil society has a central role to play in ensuring that the first key test of the Paris ‘ratchet’ mechanism – revising countries’ pledged climate actions, or Nationally Determined Contributions (NDCs), by 2020 – is robust, science-informed and strongly rooted in domestic politics. 2018-11-28-non-state-actors-climate-civil-society-guy (PDF) Full Article
actor The Role of Sub-state and Non-state Actors in International Climate Processes: Corporate Sector By www.chathamhouse.org Published On :: Tue, 27 Nov 2018 10:09:06 +0000 The Role of Sub-state and Non-state Actors in International Climate Processes: Corporate Sector Research paper sysadmin 27 November 2018 Given the challenging political contexts since 2015, the corporate sector will have a key role to play in persuading national governments how technologies and expertise have moved on since the pledges were made. — Photo by Priscilla Du Preez, ‘Climate Reality’ via Unsplash, 2017. This is one of four background papers feeding into a synthesis paper entitled The Role of Sub-state and Non-state Actors in International Climate Processes. Summary The corporate sector has traditionally engaged governments at national rather than international level in lobbying for action related to climate change. Where it has engaged at an international level, this has often been to restrain regulation and ambition, such as in air transport. Over time, many businesses have increasingly understood that there is more commercial opportunity in a strong, consistent approach to tackling climate mitigation and adaptation, and an increasing number are willing to speak up on the issue. The Paris Climate Conference in 2015 demonstrated this positive engagement. Businesses are more powerful when engaging directly with national governments on detailed policies – by demonstrating what is possible and indirectly influencing national governments’ international pledges. Traditional trade/industry sector associations and groups have tended to suffer from the ‘lowest common denominator’ effect of their least progressive members. Progressive business groups coalescing around climate ambition can help to counter this. Unlike at the Copenhagen climate talks in 2009, the business community provided a positive, supportive backdrop to the 2015 Paris talks, mindful of the public relations opportunities in taking a progressive stance and of the benefits of targets that reflected the science. The carbon market was a particular focus for corporates, which succeeded in getting emissions trading options and market mechanisms included in Article 6 of the Paris Agreement. Given the challenging political contexts since 2015, the corporate sector will have a key role to play in persuading national governments how technologies and expertise have moved on since the pledges were made. With increasing awareness of resource scarcity, businesses are pursuing ever more creative solutions. Wide recognition that the avoidance of future emissions is increasingly dependent on developing and emerging economies means that business voices from these countries will potentially be more influential in the next few years. 2018-11-28-non-state-actors-climate-corporate-duggan (PDF) Full Article
actor The Role of Sub-state and Non-state Actors in International Climate Processes By www.chathamhouse.org Published On :: Tue, 27 Nov 2018 10:18:41 +0000 The Role of Sub-state and Non-state Actors in International Climate Processes Research paper sysadmin 27 November 2018 In the current international political environment of rising populism, the role of sub- and non-state actors may become more important than ever. — Photo by UNclimatechange, ‘Bonn Climate Change Conference - October 2014’ via Flickr, 2014. Summary Climate action from sub-state and non-state actors such as subnational governments, cities, corporations and NGOs has very significant potential to enhance national efforts to curb CO2 emissions, close the so-called ‘emissions gap’ – between current commitments and the action necessary to meet climate targets – and help move the world on to a ‘1.5°C pathway’ that would limit global warming to 1.5°C above pre-industrial levels by 2100. In addition to their own climate action, sub-state/non-state actors can contribute to climate governance by developing new policies and business models to support emissions cuts and build resilience. Knowledge exchange and capacity-building have a role to play in helping these innovations to spread internationally. Politically, measures implemented by sub-state/non-state actors can help national governments to implement existing targets faster and more effectively, while helping to build political support for more ambitious climate action. The post-Paris climate regime of the United Nations Framework Convention on Climate Change (UNFCCC) reflects the growing importance of sub- and non-state actors, and has featured the creation of institutional structures to engage and coordinate them. In the current international political environment of rising populism, the role of sub- and non-state actors may become more important than ever. However, more questions about the robustness of sub- and non-state action are also likely to be raised. With the 2020 deadline approaching for countries to submit details of enhanced Nationally Determined Contributions (NDCs), long-term climate strategies and other means of raising policy ambition, the next two years are set to provide significant opportunity for sub- and non-state action. Many governments are already developing ways to engage with sub- and non-state actors to identify opportunities to strengthen action by 2020. Key questions in this respect include (a) whether sub- and non-state actors can mobilize across sectors; and (b) whether action can be extended beyond the ‘usual suspects’ to include contributions from less familiar sources, such as business sectors with limited opportunities for climate action or corporations in the Global South. 2018-11-28-non-state-sctors-climate-synthesis-hale-final (PDF) Full Article
actor The Role of Sub-state and Non-state Actors in International Climate Processes: Financial Institutions By www.chathamhouse.org Published On :: Thu, 20 Dec 2018 10:15:53 +0000 The Role of Sub-state and Non-state Actors in International Climate Processes: Financial Institutions Research paper sysadmin 20 December 2018 The trillions of dollars needed to secure the sustainable, climate-compatible pathway outlined in the 2015 Paris Agreement have focused attention on private finance and investment. — Photo by João Barbosa, ‘The need to keep growing’, 2018. This is one of four background papers feeding into a synthesis paper entitled The Role of Sub-state and Non-state Actors in International Climate Processes. Summary The trillions of dollars needed to secure the sustainable, climate-compatible pathway outlined in the 2015 Paris Agreement have focused attention on private finance and investment, and on the role of the financial sector as a potentially powerful non-state actor in the international climate debate. Leading individual financial institutions reacted to the Paris Agreement by framing it in terms of what it would mean for markets – i.e. risks and opportunities – and by underlining the importance of national implementation of climate change commitments. Key recent developments signal that the financial sector actively supports Paris-compatible government action on climate change, as well as company-level action to understand the physical and ‘transition’ risks and opportunities associated with climate change and policy responses. Financial sector engagement is taking place through well-organized and well-supported international initiatives and platforms. A critical part of this process entails robust activity by financial institutions to embed climate change and broader sustainability factors into strategies and operations. At country level, attention to implementation of Nationally Determined Contributions (NDCs) and associated sector-level policy development has been largely separate from the broader ‘sustainable finance’ dynamic. National-level action has not benefited from the same level of organized financial sector involvement evident in international action. One of the reasons for this is that, with some notable exceptions, international financial initiatives lack the capacity and resources to participate in the granular detail of national policy processes. Policymakers in turn often lack the internal capacity to consult or engage with the financial sector domestically. This paper includes some thoughts on further international and national climate actions. Ensuring that messages from successful international financial sector initiatives are heard in regional and non-climate forums offers one avenue for building a stronger foundation for greater climate ambition. Building the resource base for stronger national climate policy engagement, as a counter-voice to incumbent interests and to ensure that the quality of policy is ‘investment grade’, is another. This will be critical to the delivery of policy outcomes. Other key elements include the need to pool knowledge across relevant parts of the finance sector, build alliances, and shift action towards joint problem-solving with policymakers. A ‘Talanoa 2.020’-type initiative offers one potentially promising approach to advancing dialogue in this respect. 2018-12-21-non-state-actors-climate-financial-institutions-hamilton (PDF) Full Article
actor The Role of Sub-state and Non-state Actors in International Climate Processes: Subnational Governments By www.chathamhouse.org Published On :: Wed, 23 Jan 2019 09:34:56 +0000 The Role of Sub-state and Non-state Actors in International Climate Processes: Subnational Governments Research paper sysadmin 23 January 2019 This paper looks at the role of subnational governments in influencing global climate ambition, and makes recommendations for how these actors can increase their influence in the future. — Photo by Annie Spratt, ‘High in the SuperTrees’ via Unsplash, 2017 Summary ‘Subnational governments’ – including municipal, regional and provincial authorities – lack the formal status of negotiating parties to the United Nations Framework Convention on Climate Change (UNFCCC). But they have a vital role to play in informing and helping to shape international climate action, as they are often the key delivery partners for on-the-ground policies. Subnational governments are often closer to climate problems than the UNFCCC parties themselves, and have experience, expertise and peer influence that can support the development of progressive policies and increased ambition. Many subnational governments have joined or formed various groupings to share information and experience, and to increase their collective profile and voice. Notable initiatives and collaborations include the Under2 Coalition, ICLEI, C40 and the Global Covenant of Mayors for Climate & Energy. Subnational governments are highly diverse. In some cases, politically high-profile administrations – the US state of California being a notable example – have exploited their visibility and policy successes to engage in wider climate debates. Equally, however, subnational agendas can encounter resistance from national governments anxious to ensure the primacy of their negotiating positions in the UNFCCC system. One of the advantages that subnational governments enjoy, subject to resources, is their ability to join with peer groups to take a fresh approach to mitigation or adaptation policies. Groups of cities or subnational regions can, through collaborative organizations, explore new approaches that might be less attractive within a national context. To maintain and build on their current achievements and influence, subnational governments need, among other things, to: improve the credibility of their experience through evaluation of the success of their climate policies; use membership of appropriate international groups to share experience and boost their leverage; continue to create collaborative relationships with progressive businesses to increase influence at a national level; build on cross-regional relationships in climate adaptation and resilience; and work with other subnational actors to build momentum ahead of the first post-Paris revision of climate commitments in 2020. 2019-01-23-Duggan (PDF) Full Article
actor Correction: Transcriptional factors Smad1 and Smad9 act redundantly to mediate zebrafish ventral specification downstream of Smad5. [Additions and Corrections] By www.jbc.org Published On :: 2020-12-25T00:06:31-08:00 VOLUME 289 (2014) PAGES 6604–6618In Fig. 4G, in the foxi1 panel, the images in Fig. 4G, i and l, corresponding to “smad1 MO” and “smad5 MO + samd1/9 mRNA” samples, respectively, were inadvertently reused during figure preparation. This error has now been corrected using images pertaining to each treatment and sample. This correction does not affect the results or conclusions of the work.jbc;295/52/18650/F4F1F4Figure 4G. Full Article
actor Disruptive technologies by nation states and malign cyber actors – the US response By www.chathamhouse.org Published On :: Thu, 02 Feb 2023 12:32:13 +0000 Disruptive technologies by nation states and malign cyber actors – the US response 16 February 2023 — 1:00PM TO 2:00PM Anonymous (not verified) 2 February 2023 Chatham House and Online Lisa Monaco, the US deputy attorney general, discusses how autocratic governments and malign cyber actors use disruptive technologies to project power and engage in illicit activity. Weaponizing data, ransomware attacks and other illicit cyber activity represent significant threats to national security. Governments and malicious cyber actors around the world exploit disruptive technology to engage in criminal activity, track citizens and coerce other countries thereby weakening the rules-based order and fundamental principles of democracy. Lisa Monaco discusses how the world is at an inflection point when it comes to meeting this challenge and describes how the US and partner nations are responding to protect their citizens and the broader international community. Key questions to discuss include: What steps does the US government need to take to properly address this threat? How are countries coordinating policies to confront the problem? To what extent does this challenge go beyond US-China competition? As with all member events, questions from the audience drive the conversation. Read the transcript. Full Article
actor Clinical Factors That Influence Repeat 68Ga-PSMA-11 PET/CT Scan Positivity in Patients with Recurrent Prostate Cancer Under Observation After a Negative 68Ga-PSMA-11 PET/CT Scan: A Single-Center Retrospective Study By jnm.snmjournals.org Published On :: 2024-10-01T04:08:08-07:00 This analysis aimed to identify clinical factors associated with positivity on repeat 68Ga-PSMA-11 PET/CT after a negative scan in patients with recurrent prostate cancer (PCa) under observation. Methods: This single-center, retrospective analysis included patients who underwent at least 2 68Ga-PSMA-11 PET/CT scans (PET1 and PET2) at UCLA between October 2016 and June 2021 for recurrent PCa with negative PET1 and no PCa-related treatments between the 2 scans. Using Prostate Cancer Molecular Imaging Standardized Evaluation criteria to define negative and positive scans, the final cohort was divided into PET2-negative (PET2-Neg) and PET2-positive (PET2-Pos). The same PET1 was used twice in the more than 2 PET cases with inclusion criteria fulfilled. Patient characteristics and clinical parameters were compared between the 2 cohorts using Mann–Whitney U test and Fisher exact test. Areas under the curve (AUCs) of the receiver operating characteristic and the Youden index were computed to determine the discrimination ability of statistically significant factors and specific cut points that maximized sensitivity and specificity, respectively. Results: The final analysis included 83 sets of 2 PET/CT scans from 70 patients. Thirty-nine of 83 (47%) sets were PET2-Neg, and 44 of 83 (53%) sets were PET2-Pos. Prostate-specific antigen (PSA) increased from PET1 to PET2 for all 83 (100%) sets of scans. Median PSA at PET1 was 0.4 ng/mL (interquartile range, 0.2–1.0) and at PET2 was 1.6 ng/mL (interquartile range, 0.9–3.8). We found higher serum PSA at PET2 (median, 1.8 vs. 1.1 ng/mL; P = 0.015), absolute PSA difference (median, 1.4 vs. 0.7 ng/mL; P = 0.006), percentage of PSA change (median, +270.4% vs. +150.0%: P = 0.031), and median PSA velocity (0.044 vs. 0.017 ng/mL/wk, P = 0.002) and shorter PSA doubling time (DT; median, 5.1 vs. 8.3 mo; P = 0.006) in the PET2-Pos cohort than in the PET2-Neg cohort. Receiver operating characteristic curves showed cutoffs for PSA at PET2 of 4.80 ng/mL (sensitivity, 34%; specificity, 92%; AUC, 0.66), absolute PSA difference of 0.95 ng/mL (sensitivity, 62%; specificity, 71%; AUC, 0.68), percentage of PSA change of a positive 289.50% (sensitivity, 48%; specificity, 82%; AUC, 0.64), PSA velocity of 0.033 ng/mL/wk (sensitivity, 57%; specificity, 80%; AUC, 0.70), and PSA DT of 7.91 mo (sensitivity, 71%; specificity, 62%; AUC, 0.67). Conclusion: Patients with recurrent PCa under observation after a negative 68Ga-PSMA-11 PET/CT scan with markedly elevated serum PSA levels and shorter PSA DT are more likely to have positive findings on repeat 68Ga-PSMA-11 PET/CT. Full Article
actor 11 hospitalized after explosion at Louisville food-coloring factory By www.upi.com Published On :: Tue, 12 Nov 2024 20:00:56 -0500 An explosion at a food-coloring factory in Louisville, Ky., hospitalized at least 11, including two in critical condition, on Tuesday afternoon. Full Article
actor 11 hospitalized after explosion at Louisville food-coloring factory By www.upi.com Published On :: Tue, 12 Nov 2024 20:00:56 -0500 An explosion at a food-coloring factory in Louisville, Ky., hospitalized at least 11, including two in critical condition, on Tuesday afternoon. Full Article
actor NASA to restart Mentor-Protege program to help improve contractor diversity By www.upi.com Published On :: Tue, 29 Oct 2024 15:04:08 -0400 NASA said on Tuesday that it will restart its Mentor-Protégé Program for contractors on Friday to expand commercial markets with eligible small businesses. Full Article
actor Intraneuronal beta-Amyloid Aggregates, Neurodegeneration, and Neuron Loss in Transgenic Mice with Five Familial Alzheimer's Disease Mutations: Potential Factors in Amyloid Plaque Formation By www.jneurosci.org Published On :: 2006-10-04 Holly OakleyOct 4, 2006; 26:10129-10140Neurobiology of Disease Full Article
actor Intraneuronal beta-Amyloid Aggregates, Neurodegeneration, and Neuron Loss in Transgenic Mice with Five Familial Alzheimer's Disease Mutations: Potential Factors in Amyloid Plaque Formation By www.jneurosci.org Published On :: 2006-10-04 Holly OakleyOct 4, 2006; 26:10129-10140Neurobiology of Disease Full Article
actor Anterior Olfactory Cortices Differentially Transform Bottom-Up Odor Signals to Produce Inverse Top-Down Outputs By www.jneurosci.org Published On :: 2024-10-30T09:30:22-07:00 Odor information arrives first in the main olfactory bulb and is then broadcasted to the olfactory cortices and striatum. Downstream regions have unique cellular and connectivity architectures that may generate different coding patterns to the same odors. To reveal region-specific response features, tuning and decoding of single-unit populations, we recorded responses to the same odors under the same conditions across regions, namely, the main olfactory bulb (MOB), the anterior olfactory nucleus (AON), the anterior piriform cortex (aPC), and the olfactory tubercle of the ventral striatum (OT), of awake male mice. We focused on chemically closely related aldehydes that still create distinct percepts. The MOB had the highest decoding accuracy for aldehydes and was the only region encoding chemical similarity. The MOB had the highest fraction of inhibited responses and narrowly tuned odor-excited responses in terms of timing and odor selectivity. Downstream, the interconnected AON and aPC differed in their response patterns to the same stimuli. While odor-excited responses dominated the AON, the aPC had a comparably high fraction of odor-inhibited responses. Both cortices share a main output target that is the MOB. This prompted us to test if the two regions convey also different net outputs. Aldehydes activated AON terminals in the MOB as a bulk signal but inhibited those from the aPC. The differential cortical projection responses generalized to complex odors. In summary, olfactory regions reveal specialized features in their encoding with AON and aPC differing in their local computations, thereby generating inverse net centrifugal and intercortical outputs. Full Article
actor The Effect of Congruent versus Incongruent Distractor Positioning on Electrophysiological Signals during Perceptual Decision-Making By www.jneurosci.org Published On :: 2024-11-06T09:30:07-08:00 Key event-related potentials (ERPs) of perceptual decision-making such as centroparietal positivity (CPP) elucidate how evidence is accumulated toward a given choice. Furthermore, this accumulation can be impacted by visual target selection signals such as the N2 contralateral (N2c). How these underlying neural mechanisms of perceptual decision-making are influenced by the spatial congruence of distractors relative to target stimuli remains unclear. Here, we used electroencephalography (EEG) in humans of both sexes to investigate the effect of distractor spatial congruency (same vs different hemifield relative to targets) on perceptual decision-making. We confirmed that responses for perceptual decisions were slower for spatially incongruent versus congruent distractors of high salience. Similarly, markers of target selection (N2c peak amplitude) and evidence accumulation (CPP slope) were found to be lower when distractors were spatially incongruent versus congruent. To evaluate the effects of congruency further, we applied drift diffusion modeling to participant responses, which showed that larger amplitudes of both ERPs were correlated with shorter nondecision times when considering the effect of congruency. The modeling also suggested that congruency's effect on behavior occurred prior to and during evidence accumulation when considering the effects of the N2c peak and CPP slope. These findings point to spatially incongruent distractors, relative to congruent distractors, influencing decisions as early as the initial sensory processing phase and then continuing to exert an effect as evidence is accumulated throughout the decision-making process. Overall, our findings highlight how key electrophysiological signals of perceptual decision-making are influenced by the spatial congruence of target and distractor. Full Article
actor AMR Multi-Stakeholder Partnership Platform - Creating a movement for change through engaging multiple actors and voices By www.fao.org Published On :: Wed, 18 Aug 2021 00:00:00 GMT The Tripartite organizations (FAO, OIE, WHO) invite partners to join public discussion on the establishment of the AMR Multi-Stakeholder Partnership Platform. Full Article
actor When the Nazis Seized Power, This Jewish Actor Took on the Role of His Life By www.smithsonianmag.com Published On :: Thu, 24 Oct 2024 11:00:00 +0000 After he was forced off the German stage in 1934 by antisemitic hecklers, Leo Reuss found a daring way to hide in plain sight Full Article
actor Grain, Oilseed Risk Factors By www.cmegroup.com Published On :: Wed, 20 Jan 2021 05:00:00 -0600 Macroeconomic risks for grains and oilseeds include China's growth and FX rates. Full Article [DO_NOT_USE] CME Research Soybean Product Research Article Agriculture Options FX Featured Article Corn Economic Reports Economic Events CME Group Both Erik Norland
actor Factory Five fine tunes sports car kit designs with SolidWorks software By www.solidworks.com Published On :: Mon, 21 Aug 2006 00:00:00 -0500 Company delivers kits that car enthusiasts use to build their own replicas of classics Full Article
actor The Edge Factor TV Show Chronicles SolidWorks-Designed Bike Parts in Gnarly Competition By www.solidworks.com Published On :: Tue, 04 Oct 2011 00:00:00 -0500 Episode Showcases Performance of Straitline Components’ Custom Hydraulic Brake Line Detangler in JumpShip Competition Full Article
actor How Warren's Year as a Young Teacher Could Factor in the 2020 Campaign By www.edweek.org Published On :: Tue, 08 Oct 2019 00:00:00 +0000 The swirl of attention around Democratic presidential candidate Elizabeth Warren’s story of being forced out of a teaching job when she was pregnant intensifies the spotlight on her background and K-12 credentials. Full Article Elections