velocityconf: RT @oreillyanimals Vote Instant Wild's Digital Eyes & Ears for Wildlife Protection to win Google Global Impact Award http://t.co/Z0EetiQshZ

Olivia Nuzzi has withdrawn her protective order request against her ex-fiancé Ryan Lizza months after her relationship with RFK Jr. was made public.

While the DA may have found that George Deputy Mayor Raybin Figland had no criminal liability for allegedly sexting a teenage pupil – the Public Protector's office could still probe him for misconduct.

International Relations and Cooperation Minister Ronald Lamola threw diplomacy out the window on Tuesday and responded angrily when he was asked whether South Africa and the ANC were "protecting its friend" Frelimo in troubled Mozambique.

Announcing the brand new Tom the Dancing Bug book: Volume 8 of The Complete Tom the Dancing Bug book program is "IT'S THE GREAT STORM, TOM THE DANCING BUG!" Now accepting orders right HERE! Get your personalized / signed / sketched / swagged copy today! — Read the rest

The post Tom the Dancing Bug: "Hey, Ladies! Trump will be your protector!" appeared first on Boing Boing.

Jason M. Allen's "Theatre D'Opera Spatial" won an art competition at the 2022 Colorado State Fair, but the work was subsequently denied copyright protection due to his use of AI software to generate it and his unwillingness to disclaim that contribution to the whole. — Read the rest

The post AI artist appeals denial of copyright protection appeared first on Boing Boing.

The Committee to Protect Journalists named winner of the Chatham House Prize 2018 News Release sysadmin 5 October 2018

The Committee to Protect Journalists (CPJ) has been voted the winner of this year’s Chatham House Prize.

Why the next generation is key to protecting human rights Expert comment LToremark 23 June 2021

Strengthening youth participation in public affairs is essential to building inclusive and democratic societies that respect human rights.

Young people have always been drivers of social and economic reform, and today’s global youth population is more numerous and interconnected than ever before. While they have been at the forefront of civic rights movements in recent years, young people are largely excluded from discussions around human rights norms and how to monitor their protection and defence.

Young people are consistently underrepresented in intergovernmental mechanisms and national dialogues, which not only squanders their potential to contribute to effective solutions but also risks disengagement and disillusionment with multilateralism more broadly, at a time when many are already warning of the fraying of the international liberal order. Although there are actors and initiatives working to lift barriers to youth participation in governance – such as the UN Secretary-General’s Envoy on Youth, Jayathma Wickramanayake, or the UN 2016 Not Too Young To Run campaign – these efforts tend to fall short in effecting real change and rarely translate into institutionalized procedures.

While ‘the youth’ is a heterogenous group, comprising different ages, ethnicities, national identities and interests, their participation in realizing human rights is essential to addressing the current challenges and possibilities of human rights for future generations. This will help foster more effective solutions to rights-related challenges, re-build trust in the international human rights framework among younger demographics and broaden and deepen commitments to human rights across generations.

Human rights policies and the online environment

Young people tend to be more technologically literate than their predecessors and also represent the majority of internet users and social media consumers in many countries. They can therefore play a key role in innovating and imagining rights-based solutions to emerging problems for the human rights framework, such as illegitimate collection of data by governments and companies, microtargeting by online platforms, and the sharing of harmful content online. In many cases, international human rights practices have failed to keep pace with these changes and the challenges they bring.

Younger demographics may also approach these novel human rights issues from different starting points. For example, a UK study found that 30 per cent of 18-24 year-olds were ‘unconcerned’ about data privacy compared with only 12 per cent of those aged 55-64, and it has been shown that younger people tend to be more discerning of fake news compared to older generations. There may be a need for human rights institutions and practitioners to acknowledge and bridge these gaps in perspective and understanding to ensure long-term support for proposed solutions.

International cooperation for human rights protection

It has been suggested that young people have reaped the benefits of previous human rights-based policy reforms and have a strong sense of what rights they are entitled to and why these need to be protected through an international framework. Young people are also generally more supportive of multilateralism compared to their older counterparts, as demonstrated by a 2020 survey by Pew Research Center on global attitudes, which showed that 72 per cent of respondents aged 18-29 stated they have a favourable view of the UN, compared with 58 per cent of respondents aged 50 and older.

At a recent Chatham House workshop, young participants from countries as diverse as Lebanon, Kenya and the United States expressed concern that growing hostility towards globalization threatens to undo progress in human rights standards and multilateralism more broadly, progress that they have seen and benefitted from. The rise of nationalist and populist parties has also seen countries shift their attention inwards, as evidenced by former president Trump’s decision to withdraw the US from the Paris Agreement on climate change, and threats by Brazil’s president, Jair Bolsonaro, to follow suit.

Engaging more actively with younger individuals on global human rights reform will help ensure the long-term relevance of multilateral cooperation as well as domestic buy-in of human rights commitments.

Awareness of the interconnectivity of global problems

Young people’s proficiency on online platforms has enabled greater coordination and knowledge sharing without geographical constraints, allowing young activists – like Greta Thunberg – to inspire global movements and foster online discussions about intersectional solutions to modern-day challenges.

This intersectional and transnational lens will be a vital component of building solutions to politically or historically complex issues and can be leveraged to foster better understanding of competing human rights claims relating to issues such as land re-distribution in South Africa or limitations on freedom of movement during the COVID-19 pandemic. These democratic forums and platforms will ultimately help build a global community committed to and engaged with human rights.

Capturing the next generation’s potential

With these concerns and areas of potential in mind, how can human rights institutions and mechanisms create more meaningful avenues for youth input? 

Recent Chatham House research has suggested that multilateral institutions’ efforts to engage youth has often taken the form of ‘superficial listening’, for example inviting a high-profile youth actor to a one-off event or appointing youth delegates who are not able to participate in formal discussions or mainstream governance forums. While encouraging youth participation in meetings focused on human rights can lead to positive change, tokenism can discourage future engagement and dilute the effectiveness of the forums in question.

Capitalizing on the potential of the next generation can be achieved through integrating youth councils and advisers into national and international human rights policy processes, as well as human rights institutions. A few replicable models are already operational, such as the Y7 and the Y20 delegations – the official youth engagement groups for the G7 and G20 – that advance evidence-based proposals to world leaders ahead of the G7 and G20 summits.

At the domestic level, grassroots youth-led movements can help bridge the gap between local constituencies and international policymakers, with youth activists on the ground helping to implement human rights standards and fighting against the spread of misinformation. Strong local networks and civic spaces are essential for pushing back against human rights abuses, and youth activists should be mobilized to connect the efforts of domestic and international bodies to the real issues on the ground; for example, canvassing grassroots youth networks on domestic and traditional customs before implementing development agendas around women’s rights.

As well as providing insertion points for youth policy actors, human rights institutions must communicate their goals more effectively to younger generations and promote intergenerational and inclusive dialogue, for example by holding virtual consultations that  give access to individuals from different backgrounds. Similarly, they should ask young people about their priorities for human rights reform using regular and accessible surveys or by sharing information on online platforms regularly used by this demographic. This will ensure lasting buy-in from the next generation, essential for the relevance and sustainability of the human rights framework in the years to come.

This piece draws upon insights gathered at a workshop hosted by Chatham House in March 2021, which brought together the Institute’s networks of next generation groups including representatives of the QEII Academy Ambassadors, the Panel of Young Advisers, and the Common Futures Conversations community, as well as young members from the South African Institute of International Affairs.

Protecting universal human rights: Imagine a better world Explainer Video NCapeling 19 November 2021

Short animation examining why protecting and defending human rights ensures an equitable response to humanitarian crises and addresses economic inequality.

Human rights are not policies that can be overturned, they are not granted by governments. They belong to everyone as human beings.

For the most part, states are meeting their commitments to defend and protect universal human rights. But increasingly some governments are beginning to shy away from their obligations, and some are even actively seeking to subvert human rights.

And the regional and international bodies created and charged with defending these rights are being challenged by the rise of new powers and political movements.

Chatham House is built on big ideas. Help us imagine a better world.

Our researchers develop positive solutions to global challenges, working with governments, charities, businesses and society to build a better future.

SNF CoLab is our project supported by the Stavros Niarchos Foundation (SNF) to share our ideas in experimental, collaborative ways – and to learn about designing a better future.

Why the private sector should protect civic society Explainer Video NCapeling 10 December 2021

A short animation explaining the crucial role that the private sector can play in protecting and defending civic space.

This video explainer introduces a synthesis paper which analyses how the private sector can support the protection of civic society space.

The private sector is in a unique position to work with civil society organizations to uphold and defend civic freedoms and support sustainable and profitable business environments. Companies have the capacity, resources and expertise to enhance the protection of civic space.

By doing so, this helps create a society in which fundamental rights and the rule of law are respected and exercised by governments, private citizens, and all organizations which, in turn, is critical to a sustainable and profitable business environment.  

For more information, download the report.

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Viral infection is one environmental factor that may contribute to the initiation of pancreatic β-cell destruction during the development of autoimmune diabetes. Picornaviruses, such as encephalomyocarditis virus (EMCV), induce a pro-inflammatory response in islets leading to local production of cytokines, such as IL-1, by resident islet leukocytes. Furthermore, IL-1 is known to stimulate β-cell expression of iNOS and production of the free radical nitric oxide. The purpose of this study was to determine whether nitric oxide contributes to the β-cell response to viral infection. We show that nitric oxide protects β-cells against virally mediated lysis by limiting EMCV replication. This protection requires low micromolar, or iNOS-derived, levels of nitric oxide. At these concentrations nitric oxide inhibits the Krebs enzyme aconitase and complex IV of the electron transport chain. Like nitric oxide, pharmacological inhibition of mitochondrial oxidative metabolism attenuates EMCV-mediated β-cell lysis by inhibiting viral replication. These findings provide novel evidence that cytokine signaling in β-cells functions to limit viral replication and subsequent β-cell lysis by attenuating mitochondrial oxidative metabolism in a nitric oxide–dependent manner.

The essential fatty acid DHA (22:6, omega-3 or n-3) is enriched in and required for the membrane biogenesis and function of photoreceptor cells (PRC), synapses, mitochondria, etc. of the CNS. PRC DHA becomes an acyl chain at the sn-2 of phosphatidylcholine (PC), amounting to more than 50% of the PRC outer segment phospholipids, where phototransduction takes place. Very long chain PUFAs (VLC-PUFAs,n-3, ≥ 28 carbons) are at the sn-1 of this PC molecular species and interact with rhodopsin. PRC shed their tips (DHA-rich membrane disks) daily, which in turn are phagocytized by the retinal pigment epithelium (RPE), where DHA is recycled back to PRC inner segments to be used for the biogenesis of new photoreceptor membranes. Here, we review the structures and stereochemistry of novel elovanoid (ELV)-N32 and ELV-N34 to be ELV-N32: (14Z,17Z,20R,21E,23E,25Z,27S,29Z)-20,27-dihydroxydo-triaconta-14,17,21,23,25,29-hexaenoic acid; ELV-N34: (16Z,19Z,22R,23E,25E,27Z,29S,31Z)-22,29-dihydroxytetra-triaconta-16,19,23,25,27,31-hexaenoic acid. ELVs are low-abundance, high-potency, protective mediators. Their bioactivity includes enhancing of anti-apoptotic and pro-survival protein expression with concomitant downregulation of pro-apoptotic proteins when RPE is confronted with uncompensated oxidative stress (UOS). ELVs also target PRC/RPE senescence gene programming, the senescence secretory phenotype in the interphotoreceptor matrix (IPM), as well as inflammaging (chronic, sterile, low-grade inflammation). An important lesson on neuroprotection is highlighted by the ELV mediators that target the terminally differentiated PRC and RPE, sustaining a beautifully synchronized renewal process. The role of ELVs in PRC and RPE viability and function uncovers insights on disease mechanisms and the development of therapeutics for age-related macular degeneration (AMD), Alzheimer’s disease (AD), and other pathologies.

Nuclear Disarmament and the Protection of Cultural Heritage Research paper sysadmin 6 October 2017

States possessing nuclear weapons should be called upon to consider and publish the risks posed to cultural heritage, and their mitigation strategies, in their nuclear-weapons doctrines and policies.

Summary

• Renewed risk assessments for nuclear weapons and policies are taking place around the world in light of nuclear modernization and the changing geostrategic environment that is making the use of nuclear weapons more likely. As such the humanitarian impacts of nuclear weapons and tests have received increased attention. However, the effect on cultural heritage has so far been neglected.
• The potential for armed conflict to destroy cultural heritage has been recognized in international law since 1954. There is significant evidence on the impact of nuclear weapons on cultural heritage including the consequences of their use in Hiroshima and Nagasaki and the effect of nuclear-testing programmes in places of cultural significance since 1945. States that possess nuclear weapons have increased liabilities and responsibilities to protect cultural heritage and cultural rights. The need to protect cultural heritage should strengthen the case for reducing and eliminating nuclear weapons.
• Failure to take into account the protection of heritage in the development of nuclear weapons policies – including disarmament, non-proliferation and arms-control negotiations – significantly undermines states’ existing commitments to protecting heritage threatened by conflict.
• Risk assessments of the impact of nuclear weapons on cultural heritage and important cultural artefacts – and methods of preventing such catastrophic damage – should be part of protecting cultural heritage in every country and the subject of informed public debate. A new body of knowledge on the full range of nuclear weapons impacts would introduce a fresh perspective to inform decision-makers, international organizations and the public in thinking about nuclear weapons policies and practices.
• Risk and resilience frameworks, which provide sets of solutions for risk assessments, would allow assessments of nuclear weapons threats to heritage and highlight vulnerabilities that need to be addressed. Such frameworks would provide a basis for policymakers to identify the world’s cultural heritage most at risk and help develop mitigation strategies to ensure that it is protected. In particular, states possessing nuclear weapons should be called upon to consider and publish the risks posed to cultural heritage, and their mitigation strategies, in their nuclear weapons doctrines and policies, as a contribution to transparency and confidence-building, and as a responsibility to the world’s shared heritage. International organizations, such as the UN Educational, Scientific, and Cultural Organization (UNESCO), have a role to play in bridging security perspectives with protecting cultural heritage.

Higher consumption of these foods was linked to improved memory by the study.

A bill shielding what is now Ohio's largest online school and its sponsor from the negative consequences of accepting thousands of former Electronic Classroom of Tomorrow students is headed to Gov. John Kasich for his signature.

Soils are essential to life [...]

Social protection and decent jobs are cornerstones of agrifood systems transformation, but they require strong political commitment

Introduced in 1934, the federal duck stamp contest has raised more than $1.2 billion and protected at least 6.5 million acres across the nation. Now, an art exhibition at Connecticut’s Bruce Museum honors the competition’s history

SOLIDWORKS 3D CAD software ensures 23-ton vehicle used to maintain troop and civilian safety around the world is 'more than meets the eye'

A man goes from being sought by gangsters to being sought by God.

Teacher-student relationships matter a lot. Research suggests a number of ways to strengthen them, writes Heather C. Hill.

Matthew Gustafson, Robert and Judith Klein Professor of Finance in the Smeal College of Business at Penn State, will give the talk, “The Biodiversity Protection Discount,” at noon on Wednesday, Oct. 30, in 157 Hosler Building on the University Park campus. Lecture is free and open to the public.

In this week's episode of SA Money Report, Fin24 investigative reporter Jan Cronje delves into Public Protector Busisiwe Mkhwebane's curious investigation of the country's push for more renewable energy.

Series of changes come after reports of Highmark premium notice errors Dozens of complaints have been registered with the Delaware Department of Insurance after Highmark Blue Cross Blue Shield processed hundreds of customer birthdates incorrectly, leading to notices of higher July 1 premiums for many Medicare Supplement participants, including those in the company’s Medigap Blue […]

Expanded oversight of Pharmacy Benefits Managers possible Legislation to further regulate the Pharmacy Benefits Manager industry was passed by the General Assembly in late June and sent to the Governor with unanimous bipartisan support. HB 219, sponsored by Rep. Andria Bennett, Sen. Spiros Mantzavinos, Senate President Pro Tempore Dave Sokola, and Rep. Mike Smith, would […]

Department of Insurance will lead effort to rein in monopolistic behavior and excessive pharmaceutical costs Insurance Commissioner Trinidad Navarro announced today that the Delaware Department of Insurance will begin the process of building and enforcing regulations regarding Pharmacy Benefit Managers (PBMs) as a new law goes into effect. The new authorities of the department will […]

Citing widespread delays in mail deliveries, President Trump’s intent to use the Postal Service to suppress the vote, and reports of deliberate disruptions in daily postal operations amid a global pandemic, Attorney General Kathy Jennings announced Tuesday that Delaware and other states are suing the United States Postal Service to stop their practices. “Every American depends on […]

Attorney General Kathy Jennings and the Delaware Department of Justice’s Consumer Protection Unit have secured an agreement to obtain $337,478.96 in debt relief for former ITT Tech students in Delaware as part of a multistate settlement that a bipartisan coalition of attorneys general and the Consumer Financial Protection Bureau reached with PEAKS Trust, a private […]

Attorney General Jennings announced Tuesday that the Delaware Department of Justice’s Investor Protection Unit is participating in a consolidated nationwide enforcement action to disrupt a fraudulent precious metals scheme that has solicited more than $180 million from seniors and other investors. The Delaware Department of Justice, the U.S. Commodity Futures Trading Commission, and 29 other […]

Attorney General Kathy Jennings’ Consumer Protection Unit announced Monday that it filed an administrative lawsuit against Centerdon Group, Inc. n/k/a Hilvanim Group, Inc., a California corporation, for violating the Delaware Uniform Debt-Management Services Act, the Delaware Consumer Fraud Act and the Delaware Deceptive Trade Practices Act. “Delawareans who are struggling with debt deserve our help, […]

Attorney General Kathleen Jennings urges all Delaware residents who believe they were impacted by the data breach announced by T-Mobile in August 2021 to take appropriate steps to protect their information from identity theft. On August 17,  T-Mobile reported a massive data breach compromising the sensitive personal information of millions of current, former, and prospective […]

Federal judge ensures mifepristone access in Delaware Attorney General Kathy Jennings announced Friday that Judge Thomas O. Rice of the U.S. District Court for the Eastern District of Washington has issued an order reiterating that his injunction protecting access to mifepristone in 17 states — including Delaware — and the District of Columbia remains in […]

The Investor Protection Unit of the Delaware Department of Justice has issued a Summary Order to Cease and Desist against respondents linked to a cryptocurrency scam known as the “pig butchering scam.” A twist on the typical romance scam, the pig butchering scam is a long-term fraud in which victims are groomed over time to make investments […]

Attorney General Kathy Jennings’ Consumer Protection Unit promulgated final regulations that establish clear rules of the road for the Home Improvement Services industry in Delaware.  The regulations, issued pursuant to the Consumer Fraud Act, become effective today, November 1. The Regulation is based on hundreds of complaints received by the Department of Justice, and it requires a number […]

House Bill 180, sponsored by Representative Baumbach, has bipartisan support in General Assembly DOVER, Del. – Governor John Carney and members of the General Assembly announced legislation on Thursday that would expand protections for Delawareans affected by computer security breaches. The bipartisan legislation, House Bill 180, is sponsored by Representative Paul Baumbach. Additional sponsors include […]

Wilmington, DE. December 26, 2018– There’s an important new law affecting Delaware workplaces – the new Delaware sexual harassment law effective January 1, 2019. Sexual harassment has been illegal in Delaware workplaces for over 20 years. However, the definition has never been clearly spelled out in the law until now. There are also new requirements […]

DOVER, Del. (March 1, 2022) – The Delaware Department of Agriculture (DDA) has been warning poultry owners since January to take extra precautions to protect their birds in light of detections of highly pathogenic avian influenza (HPAI) in wild birds in the Atlantic Flyway. But after a case of HPAI was announced last week in […]

The Delaware Department of Natural Resources and Environmental Control (DNREC) and the Department of Agriculture (DDA) Forest Service are to celebrate World Wetlands Day today, Thursday, Feb. 2, by signing a cooperative agreement to manage and protect unique wetland communities that occur on state-owned forest, park and wildlife lands.

In a very daring, encouraging and so also a very pragmatic step, we see that none other than the Jaipur Bench of Rajasthan High Court while taking suo motu cognizance of the illegal constructions and encroachments on river beds and many other water bodies in a most learned, laudable, landmark, logic