Potentially dangerous comets could be spotted many years in advance by following the meteoroid trails they leave near Earth, new research shows.

NASA astronaut Suni Williams says her weight is stable aboard the International Space Station, rebutting tabloid claims that her orbital stay has made her emaciated.

The apparent non‑gravitational acceleration the extra-solar-system ‘Oumuamua exhibits is puzzling. We find that when the position and velocity of the Sun is correctly set in computing the predicted orbit, ‘Oumuamua’s trajectory can be explained with gravity and we have reproduced the unexpected gap by computation. We also propose to search for new extra-solar-system high speed...

By Leo Babauta Let’s imagine that there’s a big task you’ve been avoiding for weeks (or maybe a bunch of them!) … it just becomes this ball of dread that you don’t want to think about, but that you feel really bad that you’ve been putting off. Sound familiar? Everyone has something like this, whether […]

The post Turning Towards a Task You’ve Been Avoiding for Weeks appeared first on zen habits.

Today, we’re going to finish up the embroidery on the sample leaf for Harvest Hues. If you’re just joining in, …

Good morning, and Happy Monday! We’ll jump right into the exciting news – the embroidery kits for The Christmas Mitten …

Cybersecurity researchers have discovered a new version of a well-known Android malware family dubbed FakeCall that employs voice phishing (aka vishing) techniques to trick users into parting with their personal information. "FakeCall is an extremely sophisticated Vishing attack that leverages malware to take almost complete control of the mobile device, including the interception of incoming

Google has warned that a security flaw impacting its Android operating system has come under active exploitation in the wild. The vulnerability, tracked as CVE-2024-43093, has been described as a privilege escalation flaw in the Android Framework component that could result in unauthorized access to "Android/data," "Android/obb," and "Android/sandbox" directories, and their respective

Over 1,500 Android devices have been infected by a new strain of Android banking malware called ToxicPanda that allows threat actors to conduct fraudulent banking transactions. "ToxicPanda's main goal is to initiate money transfers from compromised devices via account takeover (ATO) using a well-known technique called on-device fraud (ODF)," Cleafy researchers Michele Roviello, Alessandro Strino

Oh dear, busy me, four months since I've posted here. Lots of quilting, a little beading, some travels, and recently several sets of house guests have made "retirement" a bit of a joke. For now, since the La Conner Quilt Festival is just around the corner (October 2-4), my subject is one small exhibition on the first floor at the Museum, which is currently up, and will remain through the Festival.

Last year at the Festival (and again this year!) Sue Spargo taught workshops on her wool applique embroidery methods. Those of us who were lucky enough to get in were invited by the Museum to exhibit our finished pieces. These marvelous creations are the subject of this post. Uneven lighting makes it difficult to get good photos, so please forgive poor color or tone on some of these photos.

In case you are unfamiliar with Sue's work, below is an example of her work. Students in her class could choose to make chicks, circles, or flowers. Most chose the chicks. Eight of her students are showing their work in the current exhibit.

My vote for the most awesome-creative piece goes to Bunny Starbuck for She Has Flown the Coop! Here it is:

Having put my chicks all in neat rows similar to Sue's example, I find it amazing that Bunny's mind took the idea and made a whole different story of it... a coop full of chicks, with two in line on the roof ready to follow the one already in the air. Don't you just love the way the lines divide the space?!




Note Bunny's use of whispy yarn to suggest little chick feathers, her use of snaps for eyes, the one chick turned full front, the one with a bead-tassled braid and glasses, and the one with beaded loop fringe and a gathered yellow ribbon (?) yo-yo. I love them! I'm in awe, Bunny!

Below is Chicks on Parade by Dorie Benson. It's so fun the way they are so close together, with two of them going in a different direction, just as you might see in a little cluster of chicks. If you click the photo to enlarge it, you can see some of Dorie's excellent stitching and hand quilting!

The next one is Chicks by Glenys Baker, who not only did all 36 chicks but also made a second quilt featuring circles (shown further down). Awesome work, Glenys!

And next is Birds of a Feather Can Dance Together by Lorraine Jones. The fun of the title is matched by the fun of Lorraine's embellishments, including her border treatment. (You'll have to see this one in person, because the light from a table lamp, made the lower corner of the photo look terrible.)

I guess most of us like to "swim the other way," as you can see in the next piece, Chickadees, by Carrie Unick. I thought many of Corrie's embellishments were especially fun and creative, so I've also included a couple of detail photos.



Last of the chicks is my piece, simply named Chicks. It was so much fun, that I made another small piece (also in the exhibition), shown at the top of this post. Both are displayed in shadow-box type frames to protect them from dust and moth damage.
Glenys Baker, in one year, made not only a 36-chicks quilt (shown above), but also a 48-circles quilt, Circles. How she keeps thinking of new embellishment variations I can't imagine. Yet each of her circles is completely unique! Her choice of border fabrics is perfect for the quilt, complimenting the flow of color among the circles.


I love the fun color combinations and the way the beads enhance her embroidery on Nancy Anders' Bodacious Blooms, a joyful wall quilt if ever there was one! (Again, I couldn't quite get the color right in the photo, so you'll just have to go to the Museum to see it in person.)


The name of Roberta Roberts' flower quilt, Memories, invites us to look closely at the flower with three ladybugs. I don't know the story, but I can tell there is one here... and I love that. Her embellishments are varied and fun as well.



There you have it... 10 quilts by 8 students who learned some methods of wool applique and embroidery from Sue Spargo, last year at the La Conner Quilt Festival. I'm so grateful to be one of them!

The quilting community is awesomely generous!!!  Thanks to all who have sent me scraps for making hexie flowers:


I really understand and appreciate that it takes time to sort through your scraps, selecting some that you feel might work for me, packing them to send, getting them to the post office. In some cases, you even took time to cut them into 2" squares for me... WOW! Bless your hearts!

The most interesting thing is that all the fabrics I've received so far are ones I might have picked myself, yet so far there are no duplicates. As of Oct. 19th, I have cut petal sets for about 650 flowers (from my own scraps and fat quarter stash, as well as scraps I've received from other quilters), all of them unique! That's about 90% of what I need to make the quilt, and certainly enough to keep me busy for a looooooong time. It will probably take me a year or so to baste and stitch all of the flowers, although I admit to going at it with a lot of gusto.

During the past 28 years of stitching beads on cloth, I've veered away from making necklaces, bracelets, and bags or purses, mostly producing wall art pieces. Thus, I've had lots of opportunities to experiment with various methods of finishing and framing my work, making it suitable for display.


I always leave ample fabric margins surrounding the actual beaded area, giving me lots of options for finishing or framing.  One simple finishing method is to wrap the extra fabric around the sides of a manufactured painting-canvas (over stretcher-bars), and lace the fabric snugly across the back, as in the photo below.


But the problem with this method, of course, is that the surface of the beading is exposed to dust and air-borne grime, which over the years may spoil the fresh look of the beading, aging the piece prematurely. So we look to frames and glass to protect our work.

Among the various methods for covering (and protecting) beadwork with glass, the following is the one I use most frequently, and like the best.  It's not very expensive, or particularly difficult, although it does take a bit of time. Even if you already know about frames, please take a look at the section called Preparing Your Bead Embroidery for Framing in the Tutorial below.

Tutorial: How to Frame bead Embroidery

Choosing a Frame

Can paranoia be a mode of historical emplotment? The catastrophe of the First World War produced a genre of pessimistic writing. Oswald Spengler’s Decline of the West was among the most widely read. Still, the era produced dozens similar: Francesco Nitti’s The Decadence of Europe: The Path To Reconstruction (1923), Albert Demangeon’s Le Déclin de l’ Europe (1923), Wythe Williams’ Dusk of Empire: The Decline of Europe And The Rise Of The United States (1937), and Arturo Labriola’s Le Crépuscule de la Civilisation: L’Occident et les peoples de couleur (1936). In all, the coming historical consciousness of the colonized world figures significantly. Drawing on Hayden White’s notion of historical emplotment, this presentation will examine the paranoid structure of such writing.

As the first-ever “full-scale planetary defense test” to deflect a space rock, the DART mission aims to show that protecting Earth from a hazardous asteroid is possible.

The debris NASA’s asteroid-touching spacecraft collected could help us learn about the origins of our solar system. But for that to happen, scientists have to protect it from just about everything.

Two hours before asteroid 2022 EB5 entered Earth’s atmosphere, scientists knew exactly when and where the space rock would strike.

The mission is a test to see if NASA could knock an Earth-bound asteroid off its path, should we ever need to.

In this tutorial, I'll show you how to install the ALIUNDE Kodi Addon on your Android TV box or Amazon Firestick, plus, unique features in ALIUNDE.

In this guide, we have put together the best 5 Android smart TVs with Android TV pre-installed. You can install Kodi right onto these TVs easily. These TVs are available from Amazon and can be purchased worldwide.

In this tutorial guide, I'll show you exactly how to install the M-E-T-V Kodi Addon on your Android TV box or Amazon Firestick, and unique features.

In this tutorial, I'll show you exactly how to install the SEALTEAM 6 Kodi Addon on your Android TV box or Amazon Firestick, plus unique features.

Chikankari specialty Step into a world where every thread tells a story and every pattern sings a story song. Chikankari House stands not only as an advertisement but as the custodian of a centuries-old art form. Traditional Indian embroidery is not only preserved here; It is celebrated, nurtured and evolved. Chikankari with its subtle beauty and intricate details weaves the fabric of India’s rich cultural story. Chikankari House: Carrying forward a valuable asset Chikankari-property History and Origins Chikankari House takes great pride in being the torchbearer of an art form that has deep roots in ancient India. Known for its exquisite beauty and subtlety, Chikankari is often associated with the Nawab’s land in Lucknow. This delicate weaving style is believed to have flourished during the Mughal era under the patronage of Noor Jahan, wife of Emperor Jehangir. Chinkari, however, is more than just embroidery and decoration; It symbolizes an interesting story told through fashion. The story begins in mythology, where Lord Krishna’s wife Radha is said to have expressed her love with unique colorful chikankari patterns embroidered on cloth This Connection imbues chikankari with divine substance and emotional meaning, and owes it and rich textiles of rich cultural heritage again Lucknow is situated. Evolution Over the Years Like a river that changes its course over time yet never abandons its source, Chikankari too went through various transformations over the centuries. Yet, it painstakingly preserved its original essence. Chikankari artisans of the past passed on their art to younger generations, ensuring that it continued with all its skill and fervour. Notable figures in history have contributed to the popularity of this intricate craft over the years. British viceroys, Queen Victoria herself, and more recently, celebrities, and fashion designers have all played crucial roles in keeping Chikankari in the public consciousness. In its nascent stages, Chikankari was typically portrayed in white-on-white embroidery on muslin cloth, epitomizing the essence of understated elegance. Over time, the craft embraced colored threads, sequins, beads, and various fabric types, transforming Chikankari into a versatile and appealing element in modern fashion. Through the eye of the House of Chikankari, this beautiful amalgamation of past and present turns a simple piece of fabric into an alluring canvas. And as the world evolves, so do we, making sure the essence of Chikankari, the legacy of Kesari, continues to enthral generations to come. The Craftsmanship of Chikankari: An Intricate Symphony of Stitches Understanding the Art When it comes to understanding the art of Chikankari, the process begins even before the first stitch is laid. The House of Chikankari starts its crafting journey with the selection of just the right fabric – one that holds onto the charm of the delicate stitches, absorbing the soul of Lucknow into its texture. Traditionally, fabrics like muslin, cotton, and silk have been used owing to their soft texture and durability. The art features multiple unique stitches, each lending a distinctive texture to the piece. One such stitch, traditionally known as the “Bakhia” or the shadow work, stands as the backbone of Chikankari. Symbolic of Chikankari’s subtlety, Bakhia is an intricate technique where the thread’s shadow reflects on the cloth, creating a play of light and shade that brings the fabric to life. The artist behind the craft Behind every piece of Chikankari art from Chikankari House is an artist – patient, dedicated and full of unimaginable skill. They are quiet poets who tell stories through their work, weaving stories of tradition and heritage. Becoming a Chikankari artisan is not a job but a professional journey, often passed down through generations. Their training usually begins at an early age, and they spend years mastering the details – from learning different fabrics to understanding patterns and knots While it’s hard to put a number on the many unsung heroes nurturing this art form, an estimated 2.5 million artists across India are associated with Chikankari, according to the European Center for Development Policy and Management , sources that this art show succeeds on a global stage, spreading the appeal of our cultural heritage far and wide. House of Chikankari Today The House of Chikankari, rooted deeply in traditional artistry, is embracing the winds of change to sail towards modernity with grace and resilience. Today, this time-honored craft marries age-old techniques with contemporary influences, gracefully striding into the global fashion arena. Modern Innovations In the realm of Chikankari, modern technology and evolving fashion sensibilities play pivotal roles in elevating this craft to cater to contemporary tastes without losing its essence. Digital Design and Promotion: Techniques such as digital embroidery design and online marketing are helping Chikankari reach global audiences. The House of Chikankari leverages social media and e-commerce to showcase its intricate designs worldwide. New Materials and Stitches: While preserving the traditional stitches, innovative materials like georgette and net are being used, along with traditional cotton and silk. The inclusion of embellishments such as sequins and beads adds to the allure of modern Chikankari outfits. Fashion Integration: Notable fashion designers and brands, including the House of Chikankari, have been instrumental in incorporating Chikankari into high fashion. Collections showcased at major fashion weeks have featured Chikankari, placing it on the global fashion map. Sustaining the Craft The journey of Chikankari, from the streets of Lucknow to the fashion capitals of the world, has been supported by various efforts to preserve its legacy. Government and NGO Efforts: Initiatives like the Geographical Indications (GI) tag for Lucknow Chikankari by the Indian government have aided in protecting its identity. NGOs and social enterprises collaborate with artisans, providing them with fair wages and better work conditions. Educational Programs: Specialized training programs and workshops aim at skill enhancement and introducing the youth to Chikankari, ensuring the inheritance of this craft by future generations. Exhibitions and Workshops: Events such as the “Chikankari Exhibition” in major cities and the participation of Chikankari craft in international craft fairs increase awareness and appreciation for this delicate embroidery work. Through these efforts, the House of Chikankari not only survives but thrives in the landscape of modern fashion and global markets. The blend of traditional craftsmanship with contemporary innovation ensures that Chikankari remains not just a craft of the past but a living tradition, evolving and growing with each stitch in time. Investing in Chikankari Investing in Chikankari is not just a purchase—it’s an embrace of a heritage, a story woven into fabric. This section provides a comprehensive guide to ensure you select authentic pieces and maintain them, so they last a lifetime. Guide to Buying Chikankari Selecting Authentic Pieces Look for Handcraftsmanship: Authentic Chikankari is hand-embroidered. Look closely at the stitching. Irregularities often indicate handwork, as opposed to the uniform stitches of machine embroidery. Fabric Quality: Traditional Chikankari is done on natural fabrics like cotton, silk, and muslin. A gentle touch and the slightly irregular texture of natural fabrics are good indicators of quality. Design Details: Authentic Chikankari flaunts intricate designs that can range from floral motifs to paisley and geometric patterns. The richness in details often signifies authentic workmanship. Where to Buy: Prefer purchasing from recognized artisans, local markets in Lucknow, or reputable online stores specializing in Chikankari. Some reputable brands connected to the House of Chikankari offer quality assurance. Price Range and Factors Affecting Cost Artisan vs. Mass-Produced: Handcrafted Chikankari pieces, especially those from skilled artisans, will be priced higher than mass-produced ones. The uniqueness and quality justify the cost. Complexity of Work: The more intricate the embroidery and the denser the design, the higher the price. Work that takes longer to produce is naturally more valuable. Fabric Type: The choice of fabric impacts the price. Silk-based Chikankari garments are pricier than those crafted on cotton due to the cost of the material. Caring for Chikankari Garments To ensure your Chikankari pieces remain as timeless as their tradition, following proper care instructions is crucial. Washing Instructions: It’s best to hand wash Chikankari clothes in cold water with a mild detergent. Avoid wringing the fabric harshly. For machine wash, use a gentle cycle. Drying and Ironing: Always dry Chikankari garments in the shade. Direct sunlight can fade the delicate threads. While ironing, place a thin cloth over the garment to prevent direct contact with the iron. Storage: Store Chikankari apparel in a cool, dry place. Use padded hangers for items like sarees and kurtas to avoid creases. For best preservation, wrap the garments in soft, breathable fabric. By following these guidelines, you can invest wisely in Chikankari, ensuring you own a piece of heritage that brings elegance and traditional charm to your wardrobe. This enduring craftsmanship, with the right care, can be part of your legacy, cherished and passed down through generations. Chikankari Future As we navigate the crowded world of fashion and fashion, the House of Chikankari remains open in the face of obstacles and opportunities. Navigating a sea of ​​change, the delicate beauty of embroidery clings to its heritage. Challenges and opportunities Challenges Competition with machine-made products: One of the most important issues is competition from faster and cheaper looms that imitate Chikankari. Preservation of traditional skills: There is a danger that the meticulous skills of Chikankari craftsmen will be lost in today’s fast-paced manufacturing environment. Economic Development: Designers often face financial challenges due to irregular demand for materials and a lot of time spent on crafts. opportunity Design innovation: Innovation that captures the essence of Chikankari while appealing to contemporary aesthetics can create new appeal. Online Marketplace: With the rise of e-commerce, Chikankari offers a global platform, connecting skilled artisans with consumers directly. Sustainable clothing: As consumers become more eco-conscious, demand for sustainable and ethically produced clothing such as chikankari may increase. What is happening in the future Trends in the fashion industry, as well as consumer preferences, point to a different future for Chikankari. There is the possibility that: Fusion Wear: Combine chikankari and western fashion elements for unique outfits. Heritage promotion: The use of chikankari as a contemporary fashion can be a cultural promotion, especially among the youth. Technology integration: Technology can provide immersive shopping experiences such as virtual reality, allowing consumers to interact with artistic origins and stories. conclusion Chikankari House, an Indian heritage fortress plays an important role in traditional handloom weaving. It’s not just historical art preservation; It supports the livelihood of countless artists. Cultural Identity: Supporting Chikankari is like preserving an irreplaceable part of India’s cultural identity. Investing in Heritage: Each purchase of a chikankari is an investment in a tradition that has been handed down for generations. Call to action: Explore the timeless beauty of authentic chikankari embroidery. There is a story embedded in every thread. Sharing history of every purchase. Chikankari House is not just alive; it is adaptive, conquering, and moving forward to meet dog after dog adorned with canine charms. It invites us to be not only spectators but participants in the preservation of this complex art form.

The post House of Chikankari: Unveiling the Secrets Behind Exquisite Embroidery appeared first on Geeky Traveller.

By Robert McGreevy A Federal Emergency Management Agency (FEMA) supervisor told aid workers to skip over Trump supporters’ homes while doling out aid after Hurricane Milton in Florida, according to internal communications and federal workers. Marn’i Washington, a FEMA Disaster Survivor Assistance crew leader for Highland County, was identified as the supervisor who allegedly gave […]

The post FEMA Supervisor Told Employees To ‘Avoid Homes Advertising Trump’ appeared first on Liberty Unyielding.

Yale medical school’s chief psychiatry resident told a TV host that people should avoid their Trump-voting relatives on Thanksgiving and Christmas. While on MSNBC with host Joy Reid, Amanda Calhoun said if you have relatives who voted for Trump, “it’s completely fine to not be around those people and to tell them why.” Calhoun suggested […]

The post Yale psychiatrist says you should avoid your Trump-voting relatives during the holidays appeared first on Liberty Unyielding.

6 Common Furniture Mistakes to Avoid

1. NASA Alert: Massive 'God of Chaos' Asteroid Apophis Makes Closest Pass by Earth Yet  Bizz Buzz
2. NASA alert! 'God of Chaos' asteroid approaching Earth on November 13 sparks worldwide concern  The Times of India
3. Nasa Alert: Massive 'God of Chaos' asteroid Apophis nears earth in closest pass yet  CNBCTV18
4. Giant Meteorite To Hit Earth On November 13? What We Know  News18
5. 'Astonishingly close': A colossal space rock could wreak havoc on Earth in 2029  Business Today

The itinerary on my 13-day Norwegian cruise was too packed. Spending only two of the 13 days at sea left me exhausted, even as a seasoned cruiser.

The UK must avoid conflict with Europe and China Expert comment NCapeling 10 October 2022

Liz Truss says she wants to take a tough line but any freedom to forge her own foreign policy is a casualty of the economic turmoil following her first budget.

The tax-cutting budget from new UK chancellor Kwasi Kwarteng was clearly not inhibited by any apparent concern for the markets’ response. But the interest rate rise it contributed to and the scepticism raining down on the Truss government should force a recognition that economic vulnerability now constrains what the UK tries to do abroad.

That would mean taking a more cautious approach than the new UK prime minister seems to want to adopt. The Treasury and the Foreign, Commonwealth and Development Office (FCDO) may sit next to each other in Whitehall’s parade of 18th century buildings, but a huge gulf lies between them.

When talking to officials, it is striking how those in one building make decisions without reference to the other. Foreign policy is made with no consideration of the UK’s need to borrow money in the markets, and budgets are written with little calculation of the effect of decisions next door – although the Cabinet Office does at least try to reconcile these.

But that approach is a luxury which the budget response and the sharp rise in national debt it will bring makes no longer affordable.

Repairing EU trade relations is priority

The first lesson is that any worsening of trade relations with the European Union (EU) is not now something the UK can afford to contemplate. The markets would take an even dimmer view of national finances if the UK were to become embroiled in an even more fractious trade dispute with its closest and largest trading partner.

When campaigning for the Conservative party leadership, Liz Truss talked tough on the Northern Ireland protocol and her unwillingness to compromise much with the EU. Since she became prime minister, sounds from both the UK and EU have been much more conciliatory, with suggestions that a deal could be just a few details away.

And yet the Truss government is still pressing ahead with the controversial legislation which would enable the UK unilaterally to walk away from parts of the treaty it signed – the House of Lords will debate the bill and its most contentious measures, such as the extensive new powers it gives ministers, on 11 October.

But there are suggestions from officials that, although Truss would lose too much face by withdrawing the legislation, the government may choose not to contest any Lords amendments vigorously.

That would be wise. The prime minister should know the financial path she has chosen with her chancellor makes carrying out the threats of walking away from a deal too costly to afford. As it is, the markets are hardly looking with equanimity on the prospect of the UK borrowing £100 billion to shield consumers from rising gas prices.

A £43 billion package of proposed tax cuts with no explanation – yet – of how the government will pay for them would be even less comfortable were the UK to take such a hard line on the Northern Ireland protocol that it provokes a trade war with the EU. Brussels can also make those calculations and, for all the recent talk of concessions, is expected to hold fast to its new position.

For the same reasons, the UK cannot afford to talk about taking a tougher line on China – as the prime minister has already done – without clearly knowing what the economic impact would be and being sure voters are prepared to pay this price. Years of courting commercial links with China mean they now weave their way through the UK economy.

The dependence of universities on Chinese students and the income they bring is already well-known and heavily debated – but the exposure of the UK economy to digital technology and components from China is even greater, and China is now the largest source of imports for the UK with £63.6 billion or 13.3 per cent of all goods imports according to the Office for National Statistics.

Much of that was laptops, computers, telecoms and phones as well as toys and clothes; there are few households or offices that will not have these products. China is also the sixth largest destination for UK exports, with £18.8 billion or 5.8 per cent of goods exports, much of it machinery and cars.

Scottish Liberal Democrat peer Lord Purvis expressed concern at these figures because of the implication that the UK’s ability to take a tough line with China on human rights was now enormously circumscribed. And defence and intelligence chiefs are also warning of the UK’s vulnerability.

Taking a hard line needs context

There are signs the government is concerned enough to begin to map out this economic vulnerability but no signs that it yet has a full picture. Without knowing the economic hit of a frostier relationship, and confidence the House of Commons accepts it, Liz Truss would be brave to label China ‘a threat to national security’ – as her supporters indicated during the leadership campaign – when she updates the integrated review of defence and security in the coming months.

Of course, foreign policy should not be inspired by commercial concerns alone. There are wider reasons to develop a clearer China strategy to help lay out a more consistent future path. On his recent trip to East Asia, UK foreign secretary James Cleverly heard from UK partners that they were disconcerted by the lurch from George Osborne’s ‘golden years’ to the Truss charge of a China ‘threat’.

When Liz Truss was UK foreign secretary, some forecast she would pursue mercantilism given her focus on forging post-Brexit trade deals but, as it turned out, that was not the spirit of her tenure.

Alzheimer's disease (AD) is characterized by neuronal loss and accumulation of β-amyloid-protein (Aβ) in the brain parenchyma. Sleep impairment is associated with AD and affects about 25–40% of patients in the mild-to-moderate stages of the disease. Sleep deprivation leads to increased Aβ production; however, its mechanism remains largely unknown. We hypothesized that the increase in core body temperature induced by sleep deprivation may promote Aβ production. Here, we report temperature-dependent regulation of Aβ production. We found that an increase in temperature, from 37 °C to 39 °C, significantly increased Aβ production in amyloid precursor protein-overexpressing cells. We also found that high temperature (39 °C) significantly increased the expression levels of heat shock protein 90 (Hsp90) and the C-terminal fragment of presenilin 1 (PS1-CTF) and promoted γ-secretase complex formation. Interestingly, Hsp90 was associated with the components of the premature γ-secretase complex, anterior pharynx-defective-1 (APH-1), and nicastrin (NCT) but was not associated with PS1-CTF or presenilin enhancer-2. Hsp90 knockdown abolished the increased level of Aβ production and the increased formation of the γ-secretase complex at high temperature in culture. Furthermore, with in vivo experiments, we observed increases in the levels of Hsp90, PS1-CTF, NCT, and the γ-secretase complex in the cortex of mice housed at higher room temperature (30 °C) compared with those housed at standard room temperature (23 °C). Our results suggest that high temperature regulates Aβ production by modulating γ-secretase complex formation through the binding of Hsp90 to NCT/APH-1.

Can the world avoid a new nuclear arms race? 18 November 2024 — 6:00PM TO 7:00PM Anonymous (not verified) 16 October 2024 Chatham House and Online

Leading experts discuss how states are expanding nuclear arsenals amid rising geopolitical challenges.

Leading experts discuss how states are expanding nuclear arsenals amid rising geopolitical challenges.

The Doomsday Clock stands at 90 seconds to midnight – the closest to global catastrophe it has ever been. As geopolitical competition intensifies, nuclear risks are resurging at an alarming rate. The collapse of key arms control agreements, such as the Intermediate-Range Nuclear Forces (INF) Treaty, has removed crucial safeguards against arms races. Efforts to extend or replace existing treaties face significant hurdles in the current geopolitical climate.

Nuclear rhetoric has become more aggressive, as evidenced by Russian and North Korean nuclear threats. Several nuclear-armed states are also engaging in extensive modernization programmes of their nuclear arsenals, potentially fuelling a new arms race.

Despite these pressures, the number of nuclear possessor states has held steady so far. The ongoing Iranian efforts to build nuclear weapons is the closest attempt by a new state to acquire nuclear weapons. As the global security environment becomes more and more tense, existing nuclear possessor states increasingly rely on their nuclear weapons. This might threaten the global consensus against nuclear proliferation.

This session examines these competing pressures and propose strategies to reduce the risks of nuclear weapons use and proliferation. Our expert panel explores diplomatic initiatives, technical measures, and policy innovations to address these critical challenges.

This expert panel discusses key questions including:

• Are we already in the middle of a global nuclear arms race?
• How can international arms control treaties be negotiated in the current geopolitical environment?
• Does a new US president change the nuclear calculus? Is the US still able to reassure allies of its ‘extended deterrence’?
• How can we reduce the risk of additional proliferation? Which states might want to acquire nuclear weapons and what can we do about it?

The institute occupies a position of respect and trust, and is committed to fostering inclusive dialogue at all events. Event attendees are expected to uphold this by adhering to our code of conduct.

MS Brown
Jul 1, 1980; 21:505-517
Reviews

Counter-terrorism measures and sanctions: How to avoid negative consequences for humanitarian action? 9 September 2021 — 2:00PM TO 3:30PM Anonymous (not verified) 21 July 2021 Online

Exploring current endeavours to address the tensions between counter-terrorism measures, sanctions and humanitarian action.

Counter-terrorism measures  address broad forms of support to terrorist acts. Their expansion, internationally and domestically, has given rise to new points of friction with international humanitarian law. Unless the measures include adequate safeguards, they  can impede humanitarian action. Country-specific sanctions imposed for other objectives, such as ending conflicts or protecting civilians, raise similar challenges for humanitarian action. 

These problems are not new, but solutions at international and national level remain elusive. 

At this panel event, which marks the launch of a new Chatham House research paper, panellists explore current endeavours to address the tensions between counter-terrorism measures, sanctions and humanitarian action.

• What are the current dynamics and developments at Security Council level?  
• What are the opportunities now that the UK is developing its independent sanctions strategy? 
• What challenges do counter-terrorism requirements in funding agreements for humanitarian action  pose? 
• What is necessary to make progress?

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Hepatocyte nuclear factor-1β (HNF-1β) is a tissue-specific transcription factor that is required for normal kidney development and renal epithelial differentiation. Mutations of HNF-1β produce congenital kidney abnormalities and inherited renal tubulopathies. Here, we show that ablation of HNF-1β in mIMCD3 renal epithelial cells results in activation of β-catenin and increased expression of lymphoid enhancer–binding factor 1 (LEF1), a downstream effector in the canonical Wnt signaling pathway. Increased expression and nuclear localization of LEF1 are also observed in cystic kidneys from Hnf1b mutant mice. Expression of dominant-negative mutant HNF-1β in mIMCD3 cells produces hyperresponsiveness to exogenous Wnt ligands, which is inhibited by siRNA-mediated knockdown of Lef1. WT HNF-1β binds to two evolutionarily conserved sites located 94 and 30 kb from the mouse Lef1 promoter. Ablation of HNF-1β decreases H3K27 trimethylation repressive marks and increases β-catenin occupancy at a site 4 kb upstream to Lef1. Mechanistically, WT HNF-1β recruits the polycomb-repressive complex 2 that catalyzes H3K27 trimethylation. Deletion of the β-catenin–binding domain of LEF1 in HNF-1β–deficient cells abolishes the increase in Lef1 transcription and decreases the expression of downstream Wnt target genes. The canonical Wnt target gene, Axin2, is also a direct transcriptional target of HNF-1β through binding to negative regulatory elements in the gene promoter. These findings demonstrate that HNF-1β regulates canonical Wnt target genes through long-range effects on histone methylation at Wnt enhancers and reveal a new mode of active transcriptional repression by HNF-1β.

In animals, the response to chronic hypoxia is mediated by prolyl hydroxylases (PHDs) that regulate the levels of hypoxia-inducible transcription factor α (HIFα). PHD homologues exist in other types of eukaryotes and prokaryotes where they act on non HIF substrates. To gain insight into the factors underlying different PHD substrates and properties, we carried out biochemical and biophysical studies on PHD homologues from the cellular slime mold, Dictyostelium discoideum, and the protozoan parasite, Toxoplasma gondii, both lacking HIF. The respective prolyl-hydroxylases (DdPhyA and TgPhyA) catalyze prolyl-hydroxylation of S-phase kinase-associated protein 1 (Skp1), a reaction enabling adaptation to different dioxygen availability. Assays with full-length Skp1 substrates reveal substantial differences in the kinetic properties of DdPhyA and TgPhyA, both with respect to each other and compared with human PHD2; consistent with cellular studies, TgPhyA is more active at low dioxygen concentrations than DdPhyA. TgSkp1 is a DdPhyA substrate and DdSkp1 is a TgPhyA substrate. No cross-reactivity was detected between DdPhyA/TgPhyA substrates and human PHD2. The human Skp1 E147P variant is a DdPhyA and TgPhyA substrate, suggesting some retention of ancestral interactions. Crystallographic analysis of DdPhyA enables comparisons with homologues from humans, Trichoplax adhaerens, and prokaryotes, informing on differences in mobile elements involved in substrate binding and catalysis. In DdPhyA, two mobile loops that enclose substrates in the PHDs are conserved, but the C-terminal helix of the PHDs is strikingly absent. The combined results support the proposal that PHD homologues have evolved kinetic and structural features suited to their specific sensing roles.

Nathan Brownlowe, Alcides Buss, Daniel Gonçalves, Jeremy B. Hume, Aidan Sims and Michael F. Whittaker
Trans. Amer. Math. Soc. 377 (), 5513-5560.
Abstract, references and article information

dannyhennesy posted a photo:

On the Capital planet the rebellious droids had followed maily the Bat-Bot, but as time progressed his circuits had gone all mushy at 780 years or so without maintenance…

Several splinter groups all with their local bot leaders emerged such as the Che-bot, the traffic-light-robot and the Butt-bot, but none of these collected enough sentient circuits to call themselves a popular (or Animata) mass movement!

That was until a cyborg came along, one known as Jones, a long time prisoner and terrorist, his easy solutions to every problem rang well in the masses' auditory circuits!!!

His slogans and simple rhetoric were simple enough for the simple traffic-light to comprehend and cheer!

His language was full of hate towards the organics and especially the humans who were the most common races among the ruling class of the federation!!!

Despite being a “Fleshie” himself his message collected the angry enslaved
bot community by only weeks all rebellious robots except for a few fringe loonies had forgotten the old leaders…

One morning at Jones gave the signal…

All over the capital planet hordes and swarms of any form of mechanical sentient beings attacked first the police stations, then the Company boards running the planet and the federation as well as their starfleet…

Many died, especially the low level police and army! Many mechanicals died too, but their ranks were soon filled by Mutant fleshie allies of the lower levels who hated the Federation feudal society and upper classes as much as their technological allies…

The Federation state apparatus and ruling class, most of their fleet army fled when they knew the game was up, they activated the emergency escape plan and whole city blocks with important factories, administrational units, valuable assets and so on separated from the capital by hidden rocket engines and homed in their course to Mars…

On Mars the federation regrouped and formed their new society…

On the Capital planet, the robots proclaimed the first Techno-republic of the advanced inorganic civilization, the low level fleshies left behind, became slaves and their mutant allies got to rule their own minute chiefdoms as protectorates under the Techno-republic…

Jones was now the undisputed ruler of the capital planet, but the victory was a pyrros one since, all important buildings, all of value was now one Mars!

But as Jones put it:

Our proud race the Techno-species didn’t need the Fleshies administration, their infrastructure, their spaceships…

We shall start from scratch, with a new administration, a new order, every droid shall work at 4x speed than they did during human oppression since now we are free and the fleshies shall work twice as hard than the Techno-Race, until we have breed enough new fleshies so they can do all work!

Our future is bright and shiny like glistering shiny metal!

The snapshot seen here is from the first police station attacked in sector 45-34v-ss-g the first one to fall according to official techno-history!

———————————————/
Designers note:

I am sad to say that this is the last episode in this years-spanning space series… At least for a while, I will still post LEGO hobby stuff here but without a storyline, perhaps small designs and builds… and occasionally a story when I feel like it!!!

I would like to thank all who had been in this journey of our heros, but it has taken far to much time and effort and since the state of the world is as it is, I am spiraling down in another depression, I must stop it before I reach the abyss, so I have remove some stress out of my equation… I ended it in a cliffhanger so I can easily restart it when my mental health improves… I hope that won’t be forever???

I would love if someone used my characters or ideas, please send me a link if you do, I would love to read it or look at it!!!

But there will be more Lego, just in different format without long stories, I need to focus more on my art and to be honest that is the only time the mental pain eases, when I create!!!


Peace and Noise!

MushroomBrain a FOL

Dylan Langharst and Dongmeng Xi
Proc. Amer. Math. Soc. 152 (), 5299-5311.
Abstract, references and article information

Pectins are a major dietary nutrient source for the human gut microbiota. The prominent gut microbe Bacteroides thetaiotaomicron was recently shown to encode the founding member (BT1017) of a new family of pectin methylesterases essential for the metabolism of the complex pectin rhamnogalacturonan-II (RG-II). However, biochemical and structural knowledge of this family is lacking. Here, we showed that BT1017 is critical for the metabolism of an RG-II–derived oligosaccharide ΔBT1017oligoB generated by a BT1017 deletion mutant (ΔBT1017) during growth on carbohydrate extract from apple juice. Structural analyses of ΔBT1017oligoB using a combination of enzymatic, mass spectrometric, and NMR approaches revealed that it is a bimethylated nonaoligosaccharide (GlcA-β1,4-(2-O-Me-Xyl-α1,3)-Fuc-α1,4-(GalA-β1,3)-Rha-α1,3-Api-β1,2-(Araf-α1,3)-(GalA-α1,4)-GalA) containing components of the RG-II backbone and its side chains. We showed that the catalytic module of BT1017 adopts an α/β-hydrolase fold, consisting of a central twisted 10-stranded β-sheet sandwiched by several α-helices. This constitutes a new fold for pectin methylesterases, which are predominantly right-handed β-helical proteins. Bioinformatic analyses revealed that the family is dominated by sequences from prominent genera of the human gut microbiota, including Bacteroides and Prevotella. Our re-sults not only highlight the critical role played by this family of enzymes in pectin metabolism but also provide new insights into the molecular basis of the adaptation of B. thetaiotaomicron to the human gut.

Madison T Wright
Nov 18, 2020; 0:RA120.002168v1-mcp.RA120.002168
Research

Ka-Won Kang
Nov 30, 2020; 0:RA120.002169v1-mcp.RA120.002169
Research

Adult progenitor cell populations typically exist in a quiescent state within a controlled niche environment. However, various stresses or forms of damage can disrupt this state, which often leads to dysfunction and aging. We built a glucocorticoid (GC)-induced liver damage model of mice, found that GC stress induced liver damage, leading to consequences for progenitor cells expansion. However, the mechanisms by which niche factors cause progenitor cells proliferation are largely unknown. We demonstrate that, within the liver progenitor cells niche, Galectin-3 (Gal-3) is responsible for driving a subset of progenitor cells to break quiescence. We show that GC stress causes aging of the niche, which induces the up-regulation of Gal-3. The increased Gal-3 population increasingly interacts with the progenitor cell marker CD133, which triggers focal adhesion kinase (FAK)/AMP-activated kinase (AMPK) signaling. This results in the loss of quiescence and leads to the eventual stemness exhaustion of progenitor cells. Conversely, blocking Gal-3 with the inhibitor TD139 prevents the loss of stemness and improves liver function. These experiments identify a stress-dependent change in progenitor cell niche that directly influence liver progenitor cell quiescence and function.

Marco De Giorgi
Dec 1, 2020; 61:1675-1686
Research Articles

Nicholas D. LeBlond
Dec 1, 2020; 61:1697-1706
Research Articles

Thibaut Bourgeois
Dec 11, 2020; 0:jlr.RA120000737v1-jlr.RA120000737
Research Articles