Adopting a healthy lifestyle by making positive changes is not always easy. It involves setting realistic goals and making gradual changes that lead to significant achievements. Generally, small positive changes are more sustainable than sudden ones. Therefore, anyone seeking to improve their diet and lifestyle should consider making minor changes that eventually have a significant ... Read more

The post The Power of Nutrition: Small Changes That Make a Big Difference appeared first on Star Two.

It is undeniable that TV has a huge impact on us. It also has a huge impact on how we live! For a long time, TV shows have started interior design movements or made them popular. These TV shows are the reason these interior designs were so famous! Downton Abbey- British Edwardian There is something ... Read more

The post Interior Design Trends – And The Shows That Inspired Them appeared first on Star Two.

Sixty years ago a teenager’s homemade ice cream raised a surprisingly complicated question: Can hot liquids freeze faster than cold ones?

Can one infinity be bigger than another?

teaser here

Thessaloniki offers visitors 2,300-plus years of history, tremendous shopping, and a Jewish story like no other in Europe. 

The following article, Maybe Tim Walz Shouldn’t Bring Up ‘That Gay Guy’, was first published on The Black Sphere.

Tim Walz is no stranger to controversy. After lying about his military record and China, people are wondering what else is he lying about...

Continue reading Maybe Tim Walz Shouldn’t Bring Up ‘That Gay Guy’ ...

Twenty years ago, people wrongly wrote off the oil industry as a dinosaur. Oil production fell after 1970, so people wrongly predicted that oil production would continue to fall ever thereafter — the “peak oil” theory. Based on this prediction, there was even a weekly newspaper column called “peak oil“, written by Tom Whipple, the […]

The post Oil is the most productive U.S. industry, debunking the myth that ‘peak oil’ was reached long ago appeared first on Liberty Unyielding.

A group of teenagers in Fife have been making a documentary about the impact of disposable vapes.

A public hearing is set to examine the events surrounding the catastrophic failure of Oceangate’s submersible.

Antonin Panenka's penalty in the Euro 1976 final birthed a whole new 12-yard tactic. But the risks were higher than anyone could imagine.

A scumbag, left-wing (is there any other kind?) doctor in Iowa is facing an uncertain future at his hospital after he began posting obscene wishes on social media saying that he hopes the children of Trump voters are murdered. The creep is question is one Dr. Mayank Sharma, 35, a pediatric cardiology fellow for the […]

The post Iowa Pediatrician Blistered for Telling Trump Voters that He Hopes Their Children Die appeared first on The Lid.

velocityconf: @tsantero @garethr No, there's just a lot that goes into producing #velocityconf. Plus the chairs are getting ready for Santa Clara + NY! :)

velocityconf: What Is the Risk That Amazon Will Go Down (Again)? http://t.co/DgnfQynjcM Thank you @bergstrom_johan for the awesome #velocityconf post.

A new FutureEd report, The Reading Revolution: How States Are Scaling Literacy Reform, tells the story of how Mississippi, Tennessee and other states at the vanguard of the reading revolution have redesigned reading instruction and raised student achievement in thousands of public schools through bold, state-level leadership. These states have addressed every aspect of early literacy, from how teachers and prospective teachers are trained to the curriculum they use, how students are assessed and whether children are retained rather than promoted to the next grade.

Denzel Washington may have let slip that director Ryan Coogler is working on a third "Black Panther" film, which Marvel has not yet announced.

"I think they say they want autonomy. I think their actions don't say the same thing," Airbnb CEO Brian Chesky recently said in an interview.

Marilyn Chinitz has worked with celebs like Tom Cruise, Michael Douglas, and Wendy Williams. She has been happily married for 38 years.

Ducati North America CEO Jason Chinnock enlisted in the US Army out of high school and served with the Third Armored Division in Desert Storm.

Côte d'Ivoire is sub Sahara Africa's biggest importer of wine, says the US department of agriculture, and it is time American companies take advantage of the market.

Teacher question: One of my colleagues told us that we should not be teaching guided reading lessons or comprehension skills or strategies. We’re using a core reading program that includes those kinds of things. He says that the science of reading proves that we would get higher reading achievement by teaching more social studies and science (he’s our science teacher) and dropping the comprehension instruction that we are providing. He’s really vocal about this. Can you help us shut him up? Shanahan’s response

Communications and Digital Technology Minister Solly Malatsi will issue a policy direction on equity alternatives to the 30% equity employment rule in the communications industry.

A Minnessota maker named Caleb Olson built the Poopcopter, an autonomous drone that seeks out dog-doo and retrieves it for disposal.

He describes it as the "world's first aerial bound self-guided dog poop removal system." See it in action below.

"The Poopcopter is capable of scanning areas defined by a user, your backyard for example, and as it scans it's performing real-time computer vision using the camera which is inside the drone," Olson says. — Read the rest

The post The Poopcopter is a DIY autonomous drone that finds and collects dog-doo appeared first on Boing Boing.

It was one of the high points in the early days of the Kamala Harris campaign, the honeymoon period where the vice president — newly minted as the Democratic nominee […]

The post Watch: Oprah Pressed Over Claims That Kamala Harris' Campaign Paid Her $1M for Political Endorsement appeared first on The Western Journal.

Ignat V. Shilov
Sep 1, 2007; 6:1638-1655
Technology

The election shows that Trumpism is here to stay Expert comment rgold.drupal 7 November 2024

World leaders must engage with the new president’s view of America’s priorities and accept that the US has changed.

In a landslide victory, former President Donald Trump has been elected to be the 47th president of the United States. This election was laden with the expectation that a dead heat would lead to delay, legal challenge, extremism, and possible violence. It has instead passed quickly, decisively, and peacefully.  More than 67 million Americans who voted for Kamala Harris have demonstrated restraint and accepted the result. By this measure, democracy in the United States has prevailed. 

Across Asia and Latin America, leaders have been preparing for a second Trump term. They are pragmatic and resolute in their belief that they can work with the once and 

also future US president. In Europe, leaders have been less certain. They have oscillated between two approaches. The first, of ‘Trump-proofing’ – an instinct if not a strategy  that builds on the quest for strategic autonomy, championed by the President of France, Emmanuel Macron. The second, a calculation by some, not least the Prime Minister of Hungary, Viktor Orbán, that they can present themselves as top-tier partners to the US in a new approach to transatlantic security. 

Trumpism is not an aberration

For eight years, world leaders and foreign policy experts have been debating whether President Trump was the cause of a radical change in the US, or merely a symptom of powerful trends in the American body politic: rising inequality, a loss of manufacturing jobs – a demographic defined by white male non-college-educated voters who feel left behind – a deeply engrained anti-elitism, and a society in desperate need of a new kind of political leadership. 

In Trump’s first term, many leaders acted on the basis that he was an aberration, not a symptom. That meant that foreign leaders assumed his policies might disappear with his future electoral defeat, and short-term strategies designed to ‘work around’ Trump were a good bet. 

The next US president would return to a familiar agenda (free trade, market access, strong alliances, a commitment to climate action, extended nuclear deterrence and deepening transatlantic ties) and so America’s friends could wait this out. Indeed, civil servants frequently pointed to the strength of bilateral working relations, despite an often disruptive high-level political style. 

President Joe Biden’s commitment to multilateralism, the transatlantic partnership and Ukraine seemed to confirm the view that Trump’s policies were an anomaly and that America had reverted to normal. Gradually, though, Biden’s policies began to chip away at this assumption. He continued Trump’s tariffs, executed a reckless and unilateral exit from Afghanistan with little consultation, and pushed through a transformative but also protectionist climate investment bill in the Inflation Reduction Act. 

Fast forward to this election result. A stunning – many would say shocking – victory must put to rest any assumption that Trump is an aberration. It may have started that way, but today it appears there is no going back. The world is now confronted with a president that has had time to sharpen and hone his instincts, to prioritise loyalty in appointing a close circle of advisers, and to lay the foundation for his Vice President JD Vance to carry forward his vision once his second term ends. 

First moves

What will Trump do first? Several things are in store: A sharp immigration policy including deportations is likely to be top of Team Trump’s agenda in its first 100 days. This may prove to be inflationary – deporting millions of undocumented migrants would shrink the labour supply – but that is unlikely to restrain Trump in the short-term. A 2.0 version of his so-called ‘Muslim ban’ could also feature. And immigrants will continue to take a hit rhetorically, labelled as outsiders and as criminals. 

The punishment for noncompliance could also be harsh. If Mexico does not demonstrate its willingness to cooperate, retaliation might take the form of tariffs, or a tough review or even renegotiation of the United States-Mexico-Canada Agreement (USMCA) in 2026. 

The return to tariffs as the front line of trade policy  is virtually certain. Trump has telegraphed this for months. China can expect far harsher tariffs. What is more difficult to discern is whether these will be a bargaining tool with conditions attached, or a ratcheting up towards a new level of protectionism. 

For Asia, there is grave uncertainty. No one can be sure what Trump’s strategy will be towards Taiwan. Investment in the latticework of mutually-reinforcing partnerships across the region may take a back seat. But how Trump will manage North Korea’s nuclear threat is unclear. So too is the question of whether under his watch, US nuclear deterrence will continue to provide enough assurance to prevent South Korea and Japan from developing their own nuclear weapons. 

Still, it is Europe that is likely to face the sharpest edge of Trump’s second term. Tariffs in search of reciprocal market access and reducing America’s trade deficit with Europe are more likely than not. But it will be the existential and enduring shift in America’s commitment to Europe and its security that will hit hardest. 

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Expert

Centrioles are key eukaryotic organelles that are responsible for the formation of cilia and flagella, and for organizing the microtubule network and the mitotic spindle in animals. Centriole assembly requires oligomerization of the essential protein spindle assembly abnormal 6 (SAS-6), which forms a structural scaffold templating the organization of further organelle components. A dimerization interaction between SAS-6 N-terminal “head” domains was previously shown to be essential for protein oligomerization in vitro and for function in centriole assembly. Here, we developed a pharmacophore model allowing us to assemble a library of low-molecular-weight ligands predicted to bind the SAS-6 head domain and inhibit protein oligomerization. We demonstrate using NMR spectroscopy that a ligand from this family binds at the head domain dimerization site of algae, nematode, and human SAS-6 variants, but also that another ligand specifically recognizes human SAS-6. Atomistic molecular dynamics simulations starting from SAS-6 head domain crystallographic structures, including that of the human head domain which we now resolve, suggest that ligand specificity derives from favorable Van der Waals interactions with a hydrophobic cavity at the dimerization site.

Benjamin Jaye and Manasa N. Vempati
Proc. Amer. Math. Soc. 152 (), 5105-5116.
Abstract, references and article information

The police have arrested an individual in the probe surrounding two bags of cash that allegedly fell from a Beryllium security vehicle en route to the Norman Manley International Airport in Kingston last week. 

Knockout mouse models have been extensively used to study the antiviral activity of IFIT (interferon-induced protein with tetratricopeptide repeats). Human IFIT1 binds to cap0 (m7GpppN) RNA, which lacks methylation on the first and second cap-proximal nucleotides (cap1, m7GpppNm, and cap2, m7GpppNmNm, respectively). These modifications are signatures of “self” in higher eukaryotes, whereas unmodified cap0-RNA is recognized as foreign and, therefore, potentially harmful to the host cell. IFIT1 inhibits translation at the initiation stage by competing with the cap-binding initiation factor complex, eIF4F, restricting infection by certain viruses that possess “nonself” cap0-mRNAs. However, in mice and other rodents, the IFIT1 orthologue has been lost, and the closely related Ifit1b has been duplicated twice, yielding three paralogues: Ifit1, Ifit1b, and Ifit1c. Although murine Ifit1 is similar to human IFIT1 in its cap0-RNA–binding selectivity, the roles of Ifit1b and Ifit1c are unknown. Here, we found that Ifit1b preferentially binds to cap1-RNA, whereas binding is much weaker to cap0- and cap2-RNA. In murine cells, we show that Ifit1b can modulate host translation and restrict WT mouse coronavirus infection. We found that Ifit1c acts as a stimulatory cofactor for both Ifit1 and Ifit1b, promoting their translation inhibition. In this way, Ifit1c acts in an analogous fashion to human IFIT3, which is a cofactor to human IFIT1. This work clarifies similarities and differences between the human and murine IFIT families to facilitate better design and interpretation of mouse models of human infection and sheds light on the evolutionary plasticity of the IFIT family.

Clostridium difficile is an anaerobic and spore-forming bacterium responsible for 15–25% of postantibiotic diarrhea and 95% of pseudomembranous colitis. Peptidoglycan is a crucial element of the bacterial cell wall that is exposed to the host, making it an important target for the innate immune system. The C. difficile peptidoglycan is largely N-deacetylated on its glucosamine (93% of muropeptides) through the activity of enzymes known as N-deacetylases, and this N-deacetylation modulates host–pathogen interactions, such as resistance to the bacteriolytic activity of lysozyme, virulence, and host innate immune responses. C. difficile genome analysis showed that 12 genes potentially encode N-deacetylases; however, which of these N-deacetylases are involved in peptidoglycan N-deacetylation remains unknown. Here, we report the enzymes responsible for peptidoglycan N-deacetylation and their respective regulation. Through peptidoglycan analysis of several mutants, we found that the N-deacetylases PdaV and PgdA act in synergy. Together they are responsible for the high level of peptidoglycan N-deacetylation in C. difficile and the consequent resistance to lysozyme. We also characterized a third enzyme, PgdB, as a glucosamine N-deacetylase. However, its impact on N-deacetylation and lysozyme resistance is limited, and its physiological role remains to be dissected. Finally, given the influence of peptidoglycan N-deacetylation on host defense against pathogens, we investigated the virulence and colonization ability of the mutants. Unlike what has been shown in other pathogenic bacteria, a lack of N-deacetylation in C. difficile is not linked to a decrease in virulence.

Bacterial low-copy-number plasmids require partition (par) systems to ensure their stable inheritance by daughter cells. In general, these systems consist of three components: a centromeric DNA sequence, a centromere-binding protein and a nucleotide hydrolase that polymerizes and functions as a motor. Type III systems, however, segregate plasmids using three proteins: the FtsZ/tubulin-like GTPase TubZ, the centromere-binding protein TubR and the MerR-like transcriptional regulator TubY. Although the TubZ filament is sufficient to transport the TubR-centromere complex in vitro, TubY is still necessary for the stable maintenance of the plasmid. TubY contains an N-terminal DNA-binding helix-turn-helix motif and a C-terminal coiled-coil followed by a cluster of lysine residues. This study determined the crystal structure of the C-terminal domain of TubY from the Bacillus cereus pXO1-like plasmid and showed that it forms a tetrameric parallel four-helix bundle that differs from the typical MerR family proteins with a dimeric anti-parallel coiled-coil. Biochemical analyses revealed that the C-terminal tail with the conserved lysine cluster helps TubY to stably associate with the TubR-centromere complex as well as to nonspecifically bind DNA. Furthermore, this C-terminal tail forms an amphipathic helix in the presence of lipids but must oligomerize to localize the protein to the membrane in vivo. Taken together, these data suggest that TubY is a component of the nucleoprotein complex within the partitioning machinery, and that lipid membranes act as mediators of type III systems.

Building carbon markets that work for Africa 31 January 2023 — 2:00PM TO 3:30PM Anonymous (not verified) 19 January 2023 Online

At this webinar, held in partnership with UNDP, speakers share experiences on carbon market advancement in Africa, highlighting challenges and obstacles.

Carbon finance offers a major opening towards meeting the goals of the Paris Agreement but progress across regions has been uneven, with the African continent accounting for just 15 per cent of voluntary carbon credits issued globally in 2021.

Harnessing the potential of carbon markets may offer one route towards closing the significant shortfall in climate financing for Africa, as well as accelerating transition in cooking and energy solutions and limiting deforestation.

Article 6 of the Paris Agreement requires significant adjustment of regulatory and policy frameworks at national level in order to align with emerging global imperatives within carbon markets. Various stakeholders, including the private sector, need to take these realities into considerations as they seek to meet commitments towards a more sustainable future.

Governments and the private sector alike need to address the obstacles that have held back Africa’s participation in carbon markets, and should explore all options including both the compliance and voluntary markets, and market-based alternatives such as emissions trading schemes and carbon taxes.

At this webinar, held in partnership with UNDP, speakers share experiences on carbon market advancement in Africa, highlighting challenges and obstacles. Speakers also explore in-country experiences and make proposals on how Africa might benefit from a functional global carbon market.

In SAS Customer Intelligence Studio, you can choose to create a new calculated variable in the Edit Value dialog box when you populate a treatment custom detail. Following creation of the new calculated

Editing and/or saving an action column can take up to a minute to display a window. There are no workarounds identified at this time.

In SAS Life Science Analytics Framework 4.6, group membership removal fails with an exception if a user is set as assignee, a candidate, or a notification recipient in a user task for a Process Flow . The Process

Certain tables that are created in SAS Scalable Performance Data (SPD) Server might not be displayed correctly by SAS Federation Server Manager. Tables that have Latin5 characters in column names encounter this

Insulin receptor substrate 2 (IRS2) is an essential adaptor that mediates signaling downstream of the insulin receptor and other receptor tyrosine kinases. Transduction through IRS2-dependent pathways is important for coordinating metabolic homeostasis, and dysregulation of IRS2 causes systemic insulin signaling defects. Despite the importance of maintaining proper IRS2 abundance, little is known about what factors mediate its protein stability. We conducted an unbiased proteomic screen to uncover novel substrates of the Anaphase Promoting Complex/Cyclosome (APC/C), a ubiquitin ligase that controls the abundance of key cell cycle regulators. We found that IRS2 levels are regulated by APC/C activity and that IRS2 is a direct APC/C target in G₁. Consistent with the APC/C's role in degrading cell cycle regulators, quantitative proteomic analysis of IRS2-null cells revealed a deficiency in proteins involved in cell cycle progression. We further show that cells lacking IRS2 display a weakened spindle assembly checkpoint in cells treated with microtubule inhibitors. Together, these findings reveal a new pathway for IRS2 turnover and indicate that IRS2 is a component of the cell cycle control system in addition to acting as an essential metabolic regulator.

The neuronal basis of complex social behavior is still poorly understood. In honeybees, reproductive investment decisions are made at the colony-level. Queens develop from female-destined larvae that receive alloparental care from nurse bees in the form of ad-libitum royal jelly (RJ) secretions. Typically, the number of raised new queens is limited but genetic breeding of "royal jelly bees" (RJBs) for enhanced RJ production over decades has led to a dramatic increase of reproductive investment in queens. Here, we compare RJBs to unselected Italian bees (ITBs) to investigate how their cognitive processing of larval signals in the mushroom bodies (MBs) and antennal lobes (ALs) may contribute to their behavioral differences. A cross-fostering experiment confirms that the RJB syndrome is mainly due to a shift in nurse bee alloparental care behavior. Using olfactory conditioning of the proboscis extension reflex, we show that the RJB nurses spontaneously respond more often to larval odors compared with ITB nurses but their subsequent learning occurs at similar rates. These phenotypic findings are corroborated by our demonstration that the proteome of the brain, particularly of the ALs differs between RJBs and ITBs. Notably, in the ALs of RJB newly emerged bees and nurses compared with ITBs, processes of energy and nutrient metabolism, signal transduction are up-regulated, priming the ALs for receiving and processing the brood signals from the antennae. Moreover, highly abundant major royal jelly proteins and hexamerins in RJBs compared with ITBs during early life when the nervous system still develops suggest crucial new neurobiological roles for these well-characterized proteins. Altogether, our findings reveal that RJBs have evolved a strong olfactory response to larvae, enabled by numerous neurophysiological adaptations that increase the nurse bees' alloparental care behavior.