Palaeontologists have pieced together the brain structure of a bird that lived 80 million years ago named Navaornis hestiae, thanks to a remarkably well-preserved fossil  

There is no fall too deep for Christ's love for us. Never lose hope, my brothers and my sisters.

Tumwater, WA — Preventing sprains and strains on the job is the aim of a new online tool from the Washington State Department of Labor & Industries.

Working at the interface of the most advanced AI and Human Intelligence, NGO is building a worldwide 'Hero's Journey' to address planetary challenges

Members increase fundamental well-being through intense daily doses of Awe, Gratitude, Laughter, Brainstorming, and Swarm Intelligence

Members increase fundamental well-being through intense daily doses of Awe, Gratitude, Laughter, Brainstorming, Communal Self-sacrifice and Swarm Intelligence

Today's AI has many different flavors and architectures, along with massive amounts of memory and processing capacity. We could probably make better use of this computational power by looking at how we can improve the quality of our queries and, as a result, make better quality decisions.

A study published in ACS Pharmacology & Translational Science indicated that long-term THC treatment can initially enhance cognition by increasing the

Here is a Storify summary of the SpotOn London session: BrainSpace, a global interest graph for

In this hour, moxie, grit, and growing up. Stories of the strength, both physical and mental, of young women. Hosted by The Moth's Executive Producer Sarah Austin Jenness. The Moth Radio Hour is produced by The Moth and Jay Allison of Atlantic Public Media.

Storytellers:

Sandra Kimokoti feels conflicted over her physical strength.

Wanjiru Kibera goes off the path in the Kenyan wilderness.

Gabrielle Shelton tries to find work as a welder.

Catherine Smyka and her male friend have the same taste in women.

Christal Brown finds a connection to her father through dance.

In this episode we take a brief look at Jetbrains' Meta Programming System, a language workbench for creating external DSLs or for extending existing languages (such as Java). In a brief telephone discussion, Konstantin Solomatov explains what the system does and how it works. The system has recently been released into public beta and will be made available under then Apache 2.0 Open Source license.

Washington, D.C.— NABiQ, the dynamic innovation sprint and creative networking event, is set to make a triumphant return for its third consecutive year promising an enhanced experience for industry professionals at the upcoming 2024 NAB Show, taking place April 13-17 (Exhibits April 14-17) at the Las Vegas Convention Center. Due to its in-person popularity among participants, NABiQ is expanding to include virtual challenges leading up to the Show.

The speed of human perception is surprisingly slow, say neuroscientists. That has important implications for our understanding of cognition and for the limits of brain computer interfaces.

A preprint reports increases in the volume of parts of the brain after lockdown.

Mind-controlling fungi are changing the ways that scientists understand host-parasite relationships.

Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.

Christelle Anaclet
Dec 12, 2012; 32:17970-17976
BehavioralSystemsCognitive

Boys and girls start out on the same biological footing when it comes to math, finds the first neuroimaging study of math gender differences in children, published this month in the journal Science of Learning.

Recent fossil finds suggest that big brains weren't an evolutionary asset to our ancestors but evolved by accident – and are likely to shrink again in the near future

Intact human brains 12,000 years old or more have been found in unexpected places such as shipwrecks and waterlogged graves, but it is unclear what preserved them

Recent fossil finds suggest that big brains weren't an evolutionary asset to our ancestors but evolved by accident – and are likely to shrink again in the near future

The use of cocaine only took off in Europe during the 19th century, after the drug was chemically isolated from coca leaves, but new evidence suggests much earlier use

Title: As Waistlines Widen, Brains Shrink
Category: Health News
Created: 8/25/2009 6:10:00 PM
Last Editorial Review: 8/26/2009 12:00:00 AM

Title: Hormone Might Help Preemies' Brains
Category: Health News
Created: 8/26/2014 4:36:00 PM
Last Editorial Review: 8/27/2014 12:00:00 AM

Title: Scientists Find Differences in Brains of Those With Dyslexia
Category: Health News
Created: 8/29/2014 9:36:00 AM
Last Editorial Review: 8/29/2014 12:00:00 AM

Title: What Is a Brainstem Migraine?
Category: Diseases and Conditions
Created: 6/16/2022 12:00:00 AM
Last Editorial Review: 6/16/2022 12:00:00 AM

Title: Exercise, Puzzles, Games: How Do They Help Aging Brains?
Category: Health News
Created: 7/21/2022 12:00:00 AM
Last Editorial Review: 7/21/2022 12:00:00 AM

It is difficult to disentangle Russian and Chinese scientists from international science cooperation. That is a good thing

YouTube has announced a major update for content creators, bringing a host of new AI-powered tools that are set to reshape video production on the platform. The announcement came at the Made on YouTube event in New York City, where the

YW storyteller contest: We were flooded with stories for the YW Storyteller contest announced on June 24. Here are some entries that almost made it.

We need to start brainstorming for ideas and features that we want on the new science portal so we'll be prepared for when we locate a web designer.

Here are a list of some other science library websites. Not all are great but I'd like for us to discuss what elements we like and which features we don't like (just as important). Please feel free to post links to other libraries you think are worthy of critique. Also, if there are general guidelines and features that you'd like to include please post about those too.

My first impression looking at these sites is how busy they all are. Lots of links and it seems overwhelming at first glance. Its a decision that we'll have to make about how much information should be quickly accessible on the main page but yet still easily usable. Caltech's library page is the most easily navigated, IMO. I like the quick drop down boxes and the selection of links. I especially like the menu for authors - as the issue of open access and author rights becomes more important on campus, we'll need to take an active role in helping the faculty understand their rights and options for publishing.


Berkeley: Chemistry: http://www.lib.berkeley.edu/CHEM/
Engineering: http://www.lib.berkeley.edu/ENGI/
Physics/Ay: http://www.lib.berkeley.edu/PHYS/

Caltech: http://library.caltech.edu/

Chicago : http://www1.lib.uchicago.edu/e/crerar/index.php3

Irvine: http://www.lib.uci.edu/libraries/science.html

Michigan: http://www.lib.umich.edu/science/

MIT Science Library: http://libraries.mit.edu/science/

Oregon Science Library: http://libweb.uoregon.edu/scilib/

Santa Cruz: http://libweb.uoregon.edu/scilib/

Wood Ants Store Short- And Long-Term Memories on Different Sides of Their Brains  ScienceAlert

New research reveals the secret behind the remarkable intelligence of some bird species

Related: Blind cave fish evolved a shrunken brain to save energy

Calling someone “bird brain” used to be considered as an insult. Birds’ brains are very small compared to those of mammals, and what’s more, they lack the heavily wrinkled cerebral cortex, which is characteristic of the human brain, and widely believed to the seat of intelligence. It was, therefore, widely assumed that birds aren’t very clever creatures, but recently this has started to change.

Related: Ravens cooperate with friends not foes

When it comes to brains, is bigger better? Can the tiny brain of a newly hatched spiderling handle problems as adeptly as the brain of a larger adult spider?

The post Tiny, new brains prove just as adept as large, mature brains among tropical orb-web spiders appeared first on Smithsonian Insider.

New research on tiny spiders has revealed that their brains are so large that they fill their body cavities and overflow into their legs, say a team of scientists at the Smithsonian Tropical Research Institute in Panama.

The post Brains of tiny spiders fill their body cavities and legs, Smithsonian researchers discover appeared first on Smithsonian Insider.

The first study to investigate how dog brains process speech shows that our best friends in the animal kingdom care about both what we say and how we say it. Dogs, like people, use the left hemisphere to process words, a right hemisphere brain region to process intonation, and praising activates dog's reward center only when both words and intonation match, according to a study in Science.

read more

Rippon, Gina, author

Lithium production has increased dramatically during the past decade. A new study has found that exposure of rainbow trout to lithium results in fast accumulation in plasma and the brain, along with decreased concentrations of ions such as sodium.

A new study has found structural brain differences that may account for callous-unemotional traits in boys.

Music can get people into the spirit of the season — as long as they have opportunities to escape it.

Watch Chuck perform at the Fortune Brainstorm: Green.

Being called a bird brain really isn't an insult, now that scientists have uncovered just how smart these feathered friends really are.

The creepy bodark tree produces unnervingly strange fruit.

A study from UC Berkeley reveals that information stimulates our dopamine-producing reward system — just like food and money.

There's an 'urgent need' for rules governing the use of lab-grown brains.

Russian tycoon Dmitry Itskov says the technology will be a reality by 2045.

Female-driven comedy stars Taylor Nichols of "PEN15" and HBO's "Perry Mason"